ARTICLE
Received 21 Dec 2015 | Accepted 5 Apr 2016 | Published 10 May 2016
Anselm Sommer1, Felix Kordowski1, Joscha Bch1, Thorsten Maretzky2, Astrid Evers2, Jrg Andra3, Stefan Dsterhft4, Matthias Michalek4, Inken Lorenzen4, Prasath Somasundaram5, Andreas Tholey5, Frank D. Snnichsen6, Karl Kunzelmann7, Lena Heinbockel8, Christian Nehls8, Thomas Gutsmann8, Joachim Grtzinger4, Sucharit Bhakdi1 & Karina Reiss1
ADAM17, a prominent member of the Disintegrin and Metalloproteinase (ADAM) family, controls vital cellular functions through cleavage of transmembrane substrates. Here we present evidence that surface exposure of phosphatidylserine (PS) is pivotal for ADAM17 to exert sheddase activity. PS exposure is tightly coupled to substrate shedding provoked by diverse ADAM17 activators. PS dependency is demonstrated in the following: (a) in Raji cells undergoing apoptosis; (b) in mutant PSA-3 cells with manipulatable PS content; and (c) in Scott syndrome lymphocytes genetically defunct in their capacity to externalize PS in response to intracellular Ca2 elevation. Soluble phosphorylserine but not phosphorylcholine inhibits substrate cleavage. The isolated membrane proximal domain (MPD) of ADAM17 binds to PS but not to phosphatidylcholine liposomes. A cationic PS-binding motif is identied in this domain, replacement of which abrogates liposome-binding and renders the protease incapable of cleaving its substrates in cells. We speculate that surface-exposed PS directs the protease to its targets where it then executes its shedding function.
1 Department of Dermatology, University of Kiel, Schittenhelmstrasse 7, Kiel 24105, Germany. 2 Arthritis and Tissue Degeneration Program, Hospital for Special Surgery at Weill Medical College of Cornell University, New York, New York 10021, USA. 3 Hamburg University of Applied Science, Ulmenliet 20, Hamburg 21033, Germany. 4 Institute of Biochemistry, University of Kiel, Olshausenstrasse 40, Kiel 24098, Germany. 5 Division of Systematic Proteome Research and Bioanalytics, Institute for Experimental Medicine, University of Kiel, Kiel 24105, Germany. 6 Otto Diels Institute for Organic Chemistry, University of Kiel, Kiel 24118, Germany. 7 Physiological Institute, University of Regensburg, Universitatsstrasse 31, Regensburg 93053, Germany.
8 Forschungszentrum Borstel, Leibniz-Zentrum fr Medizin and Biowissenschaften, Borstel 23845, Germany. Correspondence and requests for materials should be addressed to K.R. (email: mailto:[email protected]
Web End [email protected] ).
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 1
DOI: 10.1038/ncomms11523 OPEN
Phosphatidylserine exposure is required for ADAM17 sheddase function
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
The evolutionarily conserved ADAM (a disintegrin and metalloprotease) family of cell-bound proteinases regulates a plethora of biological functions via cleavage of
transmembrane substrates1. ADAM17, originally discovered as the TNF-a-converting (cleaving) enzyme, has emerged as a pre-eminent member of this family24. More than 80 ADAM17 targets have been identied to date, prominent among which are cytokines, cell surface receptors and adhesion molecules5. Although several preferential substrates such as L-selectin4,68 or tumour necrosis factor receptor type 1 (TNFR1)9,10 exist, some others are shared with the closely related protease ADAM10 (ref. 11). Substrate cleavage sites contain no consensus sequence and, remarkably, they have only one feature in common: they are located very near to the surface of the lipid bilayer12.
ADAM17 regulates cell growth through the liberation of epidermal growth factor receptor (EGFR) ligands and subsequent activation of ERK1/2 signalling1315. Although ADAM17 is the major sheddase of transforming growth factor-a (TGF-a), amphiregulin, epiregulin and heparin-binding EGF, ADAM10 is predominantly involved in the release of EGF and betacellulin14.
In the mouse, deletion of ADAM17 leads to embryonic lethality due to uncorrectable developmental defects ensuing from disrupted EGFR signalling4. In humans, ADAM17 deciency results in severe inammatory skin and bowel disease, underlining its important role for epithelial cell homeostasis16,17.
Regulation of ADAM function occurs at many levels. Exit from the endoplasmic reticulum requires interaction with inactive members of the Rhomboid family of intramembrane serine proteinases (iRhom1 and iRhom2)18,19. During ADAM17 maturation, the prodomain is removed by pro-protein convertases such as furin20. A sorting protein named phosphofurin acidic cluster sorting protein 2 reportedly regulates ADAM17 trafcking and diverts the enzyme away from degradation pathways21. On the cell surface, sheddase activity can be rapidly induced by remarkably diverse stimuli including protein kinase C (PKC) activators, purine 2 (P2) receptor agonists, broblast growth factor 7 (FGF7), Ca2 ionophores and membrane perturbants2225. Inhibition of the responsible intracellular signalling cascades abolishes these effects. How the very heterogeneous pathways triggered by these agents should convene to activate one and the same protease at the extracellular membrane surface has remained a fascinating enigma in cell biology. The fact that the cytoplasmic domain of ADAM17 is not required for sheddase activation9,2224,26 renders the mystery yet more perplexing.
Independent of any stimuli, ADAM17 sheddase activity is enhanced in cells undergoing apoptosis27. A hallmark of these cells is the breakdown of phospholipid asymmetry with a remarkable increase of phosphatidylserine (PS) exposure in the external membrane leaet28. Two major processes apparently contribute to this phenomenon. First, PS and phosphatidylethanolamine passively translocating to the external leaet are normally returned to the inner leaet through the action of ATP-dependent ippases. Second, events such as Ca2 elevation and apoptosis are accompanied by the activation of scramblases, proteins that nonspecically and bidirectionally translocate phospholipids between the outer and inner leaets of the plasma membrane29. The molecules that ip and scramble have proved very difcult to characterize. In recent times, two membrane proteins have been identied as scramblases: transmembrane protein 16F (TMEM16F)30 and Xk-related protein 8 (Xkr8)31. Apoptosis is accompanied by caspase-dependent Xkr8 activation and irreversible ippase inactivation. In contrast, TMEM16F is responsible for reversible PS exposure that occurs in response to cytoplasmic Ca2 elevation28.
PS externalization has generally been considered to mainly serve as an eat-me signal for apoptotic cells. However, it is readily conceivable that the anionic phospholipid may itself regulate cellular functions. Elliott et al.32 showed that rapid PS translocation and release of the ADAM17 substrate L-selectin occurs in cells stimulated with P2 receptor agonists independent of any apoptotic events.
Transient PS exposure has been reported not only in the context of purinergic receptor stimulation, but also in conjunction with PKC activation33 and cytosolic Ca2 elevation30. It therefore occurred to us that translocation of PS to the outer membrane leaet might represent the penultimate event common to all routes of ADAM17 activation.
Here we present evidence in support of this hypothesis. In diverse cell models, ADAM17 sheddase activity correlates with PS exposure. Substrate cleavage is inhibited by soluble phosphorylserine but not by phosphorylcholine. A cationic PS-binding motif is identied in the membrane proximal domain (MPD) of ADAM17. When this motif is exchanged, the resulting ADAM17 mutant retains its peptidolytic activity, yet physiological sheddase function is not detectable. We advance the hypothesis that the negatively charged PS head group interacts with cationic amino acid clusters present within the MPD of ADAM17. This interaction seems to be necessary for the protease to full its sheddase function.
ResultsADAM17 stimuli provoke PS exposure. The rst experiments were conducted to examine whether common ADAM17 stimuli would regularly induce PS exposure in human HaCaT keratinocytes. It was found that the potent ADAM17 activators melittin25 and Ca2 ionophore ionomycin (IO) both provoked massive PS externalization that could be followed on a real-time basis with the use of pSIVA (Annexin XII). The cell-impermeable, polarity-sensitive agent is added to the culture medium. It displays uorescence only when bound to lipid bilayers and thus faithfully reports the presence of PS that is exposed in the outer membrane leaet34 (Fig. 1a,b). Melittin induced rapid PS exposure spreading over the entire cell surface that reached a maximum in 510 min and decreased thereafter (Fig. 1a and Supplementary Movie 1). PS exposure provoked by IO was yet more rapid and remained sustained over the time of observation (Fig. 1b and Supplementary Movie 2). PS externalization induced by the PKC activator phorbol 12-myristate 13-acetate (PMA) and the physiologic ADAM17 activator FGF7 was less pronounced and conventional staining with uorescent-labelled Annexin V was employed because of higher sensitivity (Fig. 1c,d and Supplementary Fig. 1). Several waves of discrete, punctate staining became detectable over an extended period of 90 min. The oscillating nature of PS exposure was particularly conspicuous with FGF7 (Fig. 1d and Supplementary Fig. 1). The differences in kinetics and localization of surface-exposed PS possibly reect the different signalling pathways triggered by the respective stimuli. The impression was gained that patterns of PS exposure also exhibited a degree of cell-type specicity. Stimulation of endothelial cells with IO led to an Annexin-staining pattern that appeared distinct from that observed in HaCaT keratinocytes (Supplementary Movie 3).
Inhibitors of ADAM17-mediated shedding blunt PS exposure. Shedding of EGFR ligands is differentially induced by various stimuli. For example, FGF7 induces EGFR activation in keratinocytes via cleavage of heparin-binding EGF24, whereas TGF-a release remains hardly detectable (Supplementary Fig. 2).
Furthermore, prolonged times are usually required for levels of
2 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
a
0-min Mel 10-min Mel 30-min Mel
800 600 400 200
0
Rel. uor. area (m 2 )
+ Mel
pSIVA pSIVA AnnexinV-FITC AnnexinV-FITC
15
10
5
0 5 10
15
20
25
30
Time (min)
b
0-min IO 10-min IO 30-min IO
800 600 400 200
0
Rel. uor. area (m2)
Rel. uor. area (m2)
Rel. uor. area (m2)
+ IO
15
10
5
0 5 10
15
20
25
30
Time (min)
c
5-min PMA 15-min PMA 120-min PMA
5-min FGF7 15-min FGF7 120-min FGF7
15
10
5
0
15
10
5
0
0 15 30 45 60 75 90 105120
Time (min)
0 15 30 45 60 75 90 105120
Time (min)
d
Figure 1 | ADAM17 stimuli induce PS exposure. (a,b) HaCaT keratinocytes were stimulated with melittin (Mel, 1 mM) or IO (1 mM) and analysedfor PS exposure via live-cell imaging using the polarity-sensitive PS-binding dye pSIVA. The mean uorescence area was quantied for statistical analysis (Mel: n 5; s.e.m.; IO: n 3; s.e.m.). (c,d) HaCaTs were stimulated with PMA (300 ng ml 1) or FGF7 (100 ng ml 1) and stained with Annexin VFITC
after the indicated time points. The mean uorescence area was quantied for statistical analysis (nZ3; s.e.m.). Unstimulated cells were used as control (squares). Scale bars, 10 mm.
shed substrates to become measurable in keratinocytes. Thus, TGF-a release can only serve as indication for ADAM17 activation and not provide a direct correlation. By contrast, the assessment of ERK1/2 activation provides an attractive option for a faster readout. Indeed, it was found that all stimuli induced ERK1/2 phosphorylation that was inhibited by the EGFR-blocking antibody Cetuximab, by the metalloprotease inhibitor marimastat (MM) and, to a large extent, by the ADAM17 inhibitory antibody D1 (ref. 35) (Supplementary Fig. 3). PMA, IO and melittin all provoke the release of TGF-a and this substrate was additionally quantied in the respective experiments.
The question followed whether inhibition of sheddase activity would be mirrored by lack of PS exposure. Cells were exposed to the stimuli in the absence or presence of respective inhibitors. As shown in Fig. 2a,b, the P2R antagonist suramin, the calcium chelator EGTA, the PKC inhibitor staurosporine and the
Src-kinase inhibitor PP2 all suppressed EGFR-dependent ERK1/2 activation. Release of TGF-a was reduced accordingly.
The latter was inhibited by MM and the ADAM17/ADAM10 inhibitor GW, but not by the ADAM10 inhibitor GI. Conspicuously, blunted ADAM17 activation was in every case associated with the absence of PS externalization (Fig. 2c).
Induction of substrate release is blunted in PSA-3 cells. Mammalian cells contain two PS synthases (PSS). PSS1 synthesizes PS from phosphatidylcholine (PC), while PSS2 synthesizes PS from phosphatidylethanolamine. PSA-3 cells are a mutant CHO-K1 cell line defective in PSS1 activity. PS levels decrease when the cells are cultured in the absence of exogenous PS and the reduced PS content of the cells can be normalized by culturing in the presence of ethanolamine36. In the next experiments,
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 3
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
a
Mel
IO
PMA
FGF7
co co Sur
co co EGTA
co co Stauro
co co PP2
kDa 44
42
44
42
pERK
ERK
kDa 44
42
44
42
pERK
ERK
kDa 44
42
44
42
pERK
ERK
kDa
44
42
44
42
pERK
ERK
b
15
40
20
NS
TGF-(pg ml1 )
TGF-(pg ml1 )
*
*
TGF-(pg ml1 )
NS
15
*
10
NS
30
20
10
5
# #
#
# #
5
10
#
0
#
#
#
0
0
co
MM GI
GW Sur
co
MM GI
GW EGTA
co
MM GI
GW Stauro
+ Melittin + Ionomycin + PMA
c
co Mel Mel + Sur
400
300
200
100
0 co Mel Mel
+Sur
Rel. uor. area (m2 )
Rel. uor. area (m2 )
*
AnnexinV-FITC AnnexinV-FITC AnnexinV-FITC AnnexinV-FITC
#
co IO IO + EGTA
1,500 1,000
500
0 co IO IO
+EGTA
*
#
co PMA PMA + Stauro
Rel. uor. area (m2 )
Rel. uor. area (m2 )
80
60
40
20
*
#
0 co PMA PMA
+stauro
co FGF7 FGF7 + PP2
*
80
60
40
20
#
0 co FGF7 FGF7
+PP2
Figure 2 | ADAM17 inhibitors abrogate PS exposure. HaCaT keratinocytes were stimulated with melittin (Mel, 1 mM), IO (1 mM), PMA (300 ng ml 1) or FGF7 (100 ng ml 1) in the presence or absence of P2 receptor inhibitor suramin (Sur, 50 mM), EGTA (10 mM), PKC inhibitor staurosporine (Stauro, 1 mM)
or Src-kinase inhibitor (PP2, 10 mM). (a) pERK1/2 analyses were undertaken as readout for ADAM17-dependent EGFR transactivation 15 min after stimulation. Representative western blottings show abrogation of ERK1/2 activation in the presence of the inhibitors. Total ERK1/2 immunoblots are included as control. (b) The supernatant was analysed for soluble TGF-a by enzyme-linked immunosorbent assay (ELISA) 30 min after stimulation. All stimuli signicantly increased soluble TGF-a shedding (n 36; s.e.m.; *Po0.05). Stimulation inhibitors, broad spectrum metalloprotease inhibitor MM
(10 mM), ADAM17/10 inhibitor (GW, 2 mM) but not ADAM10 inhibitor GI (2 mM) signicantly reduced TGF-a shedding (n 36; s.e.m.; #Po0.05). NS,
nonsignicant. (c) Cells were stained with Annexin VFITC 15 min after stimulation in the presence or absence of the respective inhibitors. Representative images are shown. The mean uorescence area was quantied for statistical analysis. *A signicant increase compared with untreated controls (n 3;
s.e.m; *Po0.05). #Signicant decrease compared with stimulated cells. Data were analysed by one-way analysis of variance and Bonferroni multiple comparison post hoc test. Scale bars, 10 mm.
4 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
a
+ IO
0 min 10 min 30 min
pSIVA pSIVA Rel. uor. area (m2)
+ Etn
w/o Etn
b c
1,500
1,000
500
0
15
+ Etn
w/o Etn
3
*
TGF--AP activity
(relative increase)
+ Etn
w/o Etn
+ IO
2
1
10
5
10
0 5 15
20
25
30
0 co co
IO IO
Time (min)
Figure 3 | ADAM17 activation depends on PS exposure. PSA-3 cells were either cultured in the presence of ethanolamine ( Etn) or starved (w/o Etn)
before IO (1 mM) stimulation. (a) PS exposure was determined by pSIVA live-cell imaging. Representative images are shown. Scale bars, 10 mm.(b) The mean uorescence area of one representative of three independent experiments was quantied over time. (c) The release of transfected AP-tagged
TGF-a was used as readout for ADAM17 activity. *A signicant increase compared with control (n 6; s.e.m.; *Po0.05). Data were analysed by
one-way analysis of variance and Bonferroni multiple comparison post hoc test.
PSA-3 cells were transfected with alkaline phosphatase (AP)-tagged TGF-a to provide a common target for ADAM17.
Cells were cultured either in medium supplemented with fetal calf serum (FCS) and ethanolamine or in medium supplemented only with dialysed FCS for 72 h. Cells were then transfected and after 24 h stimulated with IO and analysed by pSIVA live-cell imaging (Fig. 3a,b). Inhibitor experiments conrmed that ADAM17 was responsible for the IO-induced TGF-a release in these cells (Supplementary Fig. 4). As shown in Fig. 3a,b (and Supplementary Movies 4 and 5), cells cultured in the presence of ethanolamine responded with PS exposure and abundant release of TGF-a (Fig. 3c), while cells deprived of their PS source exposed little PS and shed little TGF-a.
PS exposure is required for shedding accompanying apoptosis. PS exposure is the hallmark of apoptosis and apoptosis is a trigger of ADAM-mediated substrate release27,37,38. However, human Raji lymphoma cells undergoing apoptosis expose minimal amounts of PS39,40 due to low expression of the caspase-activated scramblase Xkr8 (ref. 31). A unique possibility thus arose to examine whether PS externalization and ADAM17-mediated shedding were tightly coupled events. TNFR1 is predominantly cleaved by ADAM17 (ref. 10) and present on Jurkat and Raji cells. Exposure to agonistic anti-Fas antibody (Fas-Ab) resulted in PS externalization in Jurkat (Fig. 4a, left panel) but not in Raji cells (Fig. 4b, left panel), despite induction of apoptosis (Fig. 4c). Strikingly, TNFR1 shedding accompanying apoptosis occurred only in Jurkat cells (Fig. 4a, middle and right panel). The PS-positive cell population (P1) showed a nearly complete loss of the TNFR1, which was rescued by MM (Fig. 4a)
and the ADAM17 inhibitory antibody D1 (Supplementary Fig. 5). In contrast, the PS-negative cells (P2) were barely affected. These data indicate that activation of the apoptotic signalling cascade itself is not the trigger of ADAM17 activation and underline the importance of PS exposure for the shedding event.
Defective PS externalization results in reduced shedding. Blood cells from Scott syndrome patients present a counterpart to Raji cells. These cells have a missense mutation in TMEM16F, the scramblase that is responsible for rapid PS exposure in response to Ca2 elevation in blood cells30,41. In contrast, PS exposure provoked via other pathways including Fas-triggered apoptosis remains undisturbed. The major consequence of the defect is therefore relatively restricted to platelet malfunction, which underlies the clinical manifestation of this rare bleeding disorder.
ADAM17 is a major sheddase of L-selectin on leukocytes68, which can conveniently be assessed by ow cytometry. Scott cells showed the same cell surface expression of ADAM17 as control cells, so that comparable basic conditions for assessment of shedding were given (Supplementary Fig. 6a).
When calcium ionophore was applied to control B cells, ow cytometric analyses revealed rapid PS exposure that was parallelled by loss of L-selectin from the cell surface (Fig. 5a,b and Supplementary Fig. 6b). The temporal congruence between the two events, revealed here at the single-cell level, was impressive.
L-selectin shedding was abrogated in the presence of MM and strongly reduced by the ADAM17 inhibitory antibody D1 (Supplementary Fig. 6c). Intriguingly, Scott lymphocytes responded to the ionophore neither with PS exposure nor with shedding of the ADAM17 substrate (Fig. 5a,c). However, and in
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 5
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
a
Jurkat
Raji
250 200 150 100
50
0 0 102 103 104 105 0 102 103 104 105
0 0 102 103 104 105 0 102 103 104 105
0 0 102 103 104 105
250 200 150 100
50
0
Control+ Fas-Ab
Jurkat Jurkat
IsotypeControl+ Fas-Ab+ Fas-Ab + MM + Fas-Ab P1+ MM
250 200 150 100
50
Isotype Control+ Fas-Ab P1 + Fas-Ab P2
Cell count
Cell count
Cell count
P2
P1
Annexin-FITC
TNFR1-APC
TNFR1-APC
b c
Raji
250 200 150 100
50
Jurkat Raji
Control+ Fas-Ab Isotype
Control+ Fas-Ab
6
Cell count
Cell count
200
150
100
50
0
*
Caspase activity
(x-fold increase)
*
4
2
# #
0
co
Z-VAD Z-VAD
Annexin-FITC
TNFR1-APC
co + Fas-Ab + Fas-Ab
Figure 4 | Apoptosis only activates ADAM17 sheddase activity in the presence of PS exposure. Jurkat cells (a) and Raji lymphoma cells (b) were stimulated with agonistic anti-Fas antibody (Fas-Ab, 500 ng ml 1) in the presence or absence of MM (10 mM) for 2 h. Flow cytometric analysis of PS exposure (Annexin VFITC staining) and TNFR1 expression was performed. Fas stimulation induced PS externalization (a, left panel) and TNFR1 shedding (a, middle and right panel) in Jurkat cells but not in Raji cells (b). The PS-positive cell population (P1) nearly completely lost TNFR1 (a, right panel, red line), while the PS negative population (P2) was hardly affected (a, right panel, green line). MM (a, dotted purple line) rescued the induced shedding. Representative results of three independent experiments are shown. (c) Caspase-3 cleavage was analysed in parallel in the presence or absence of caspase inhibitor Z-VAD (10 mM). Caspase activation was signicantly induced (n 3; s.e.m.; *Po0.05) in both cell types. Z-VAD signicantly reduced caspase
activation (n 3; s.e.m.; #Po0.05). Data were analysed by one-way analysis of variance and Bonferroni multiple comparison post hoc test.
telling contrast, exposure to Fas antibody led to PS exposure on these cells and to concomitant loss of L-selectin (Fig. 5d), as observed in normal lymphocytes (Supplementary Fig. 6d).
Soluble phosphorylserine suppresses sheddase function. Should surface-exposed PS be inuencing ADAM17 function through interaction of the phospholipid head group with the protease, this would most probably occur at the extracellular membrane surface and might be competitively inhibitable by soluble phosphorylserine (OPS, O-phospho-L-serine). This question was addressed in different cell lines for different ADAM17 substrates.
ERK1/2 phosphorylation in HaCaT keratinocytes in response to PMA stimulation was dose dependently inhibited by OPS, but not by the PC head group O-phosphocholine (OPC) (Fig. 6a). Release of TNFR1 can be induced in human umbilical vein endothelial cells (HUVECs) by diverse stimuli. Inhibitor experiments conrmed that ADAM17 is signicantly involved in this process (Supplementary Fig. 7). Stimulation of HUVECs in the presence of 10 mM OPS or OPC yielded results comparable to the previous data. OPS but not OPC suppressed shedding of the TNFR1 (Fig. 6b). A similar picture emerged for the release of AP-tagged TGF-a from transfected COS7 cells (Fig. 6c).
Fluorogenic peptide substrate assays were then performed in an attempt to clarify whether OPS might directly affect the enzyme. COS7 cells can be transfected to an extent that permits surface-expressed ADAM17 activity to be detected under cell culture conditions. Of note, stimulation of COS7 cells with PMA led to no increase in peptide turnover (Supplementary Fig. 8). Thus, bona de peptidolytic activity and substrate cleavage are distinguishable entities.
Cleavage of the uorogenic peptide substrate was inhibited by the broad-spectrum metalloprotease inhibitor MM and the
inhibitor GW. Conspicuously, however, no inhibitory effect of OPS on cleavage of the soluble substrate was observed. It followed that OPS was not directly interfering with the catalytic function of the protease (Fig. 6d).
The exible MPD of ADAM17 binds to PS. The collective ndings indicated that the release of transmembrane substrates relied on physical interaction of ADAM17 with surface-exposed PS. It appeared likely to be that the site for such an interaction would be located close to the membrane and the MPD of ADAM17 (Fig. 7a) presented itself as the most probable candidate. Recombinant MPD was prepared and employed in experiments using isothermal titration calorimetry (ITC). In contrast to the control (Supplementary Fig. 9), thermic reactions indicative of proteinlipid interaction were indeed detected when the MPD was titrated into buffer solutions containing PS but not PC liposomes (Fig. 7b).
Protein-disulde isomerase (PDI) can induce a conformational change in the isolated MPD. The carboxy-terminal part of the non-PDI-treated MPD, also referred to as open MPD, is largely unstructured and exible, but becomes structured and inexible due to isomerase-mediated rearrangement of disulde bonding42. When the PDI-treated MPD was injected into a solution containing PS liposomes or PC liposomes in ITC experiments, no reaction could be observed (Fig. 7c), indicating that the PS-binding motif must be part of the PDI-affected exible region (Supplementary Fig. 10). NMR spectroscopy was used to further examine the binding of OPS to both MPD forms. 1H-15N-HSQC spectra revealed a specic interaction when OPS was added to the exible open MPD (Fig. 7d, left panel) but not on addition to the PDI-treated MPD (Fig. 7d, right panel).
6 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
Three-dimensional heteronuclear NMR experiments were performed, to identify the PS-interacting amino acid side chains. Resonance 1 could be identied as a lysine residue proceeded by a glycine, whereas resonance 2 was indicative of the NH resonances of an arginine side chain. The resonance of L624 was slightly
shifted on the addition of OPS, indicating close proximity to the OPS-binding site. The MPD sequence contains one eligible motif, namely R625/K626/G627/K628 (Fig. 7d, left panel).
A cluster of basic amino acids mediates MPDPS interaction. Plasma coagulation factors and lactadherin bind with high afnity to surface-exposed PS either directly via discoidin-like domains or indirectly via Ca2 bridges43, but none of the responsible motifs are present in the MPD. Interactions of cytosolic proteins such as Src kinase with ionic phospholipids are, in contrast, typically governed by electrostatic attraction of clusters of cationic amino acids to the membrane44 and the possibility arose that such a situation might exist for ADAM17.
Recombinant MPD was produced in which the three basic amino acids R625/K626/K628 were mutated to neutral glycins (MPD-3x) (Fig. 8a). Intact protein mass spectrometry (MS) conrmed that all ten cysteines were involved in disulde linkages (Supplementary Fig. 11a) and liquid chromatographytandem MS (LCMS/MS) experiments performed on peptides formed by proteolysis conrmed the presence of a disulde-linked key peptide proving the open conformation of this mutant MPD42 (Supplementary Fig. 11b).
Non-mutated and MPD-3x were employed in surface acoustic wave experiments using biosensor chips coated with either PC or PS liposomes. Non-mutated MPD was found to bind to PS but not to PC liposomes (Fig. 8b). Despite the presence of several remaining positively charged residues, this PS-binding capacity was completely abolished in the open MPD-3x mutant (Fig. 8c).
To assess the relevance of this motif and neighbouring positively charged amino acids for sheddase function, ADAM17 mutants were constructed in which glycine replaced either K643/ R644 (A17-KR) or R625, K626 and K628 (A17-3x) or both motifs (ADAM17-5x). Sheddase function was assessed in murine embryonic broblasts that were co-transfected with AP-tagged TGF-a. Although ADAM17 is the major sheddase of TGF-a under normal conditions, ADAM10 releases this substrate in the absence of ADAM17 (ref. 7). Therefore, ADAM10/ADAM17 double-decient cells were employed for retransfection experiments. These cells were derived from the corresponding knockout embryos that die around embryonic day 8.5 and show severe developmental defects quite similar to ADAM10 single decient mice45 (Supplementary Fig. 12).
As shown in Fig. 8d, shedding of TGF-a was induced by PMA, IO and melittin in cells transfected with wild-type (WT)-ADAM17 but not with the enzymatically inactive ADAM17-E/A mutant. Transfection with the ADAM17-KR mutant also completely restored shedding activity. However, shedding was almost completely absent in cells re-transfected with ADAM17-3x. This effect was not further inuenced by additional deletion of the KR-motif (ADAM17-5x).
Exit from the endoplasmic reticulum and maturation of ADAM17 are dependent on interaction with proteolytically inactive members of the Rhomboid family of intramembrane
a
+ IO
Mean uor. (a.u.)
1,500
1,000
500
0
0 6
2
4
Time (min)
Wild type L-selectin APC uorescence
Wild type PS pSIVA uorescence
Scott L-selectin APC uorescence
Scott PS pSIVA uorescence
pSIVA-FITC
b
B-cells wild-type
105
104
103
102
Before IO 6-min IO
L-selectin-APC
L-selectin-APC
105
104
103
102 102
0
0
102
0 103 104 105
0
105
104
103
102 102
103 104 105
pSIVA-FITC
103 104 105
0 103 104 105
0
pSIVA-FITC
pSIVA-FITC
103 104 105
0 103 104 105
0
Annexin V-FITC
Annexin V-FITC
c
B-cells scott
L-selectin-APC
Before IO 6-min IO
105
104
103
102 102
L-selectin-APC
L-selectin-APC
0
d
B-cells scott
Control 6 h Fas-AB 6 h
105
104
103
102 102
L-selectin-APC
105
104
103
102 102
Figure 5 | Defective PS externalization abolishes ADAM17-mediated shedding. Normal B cells and B cells from Scott syndrome patients were monitored by ow cytometry for induction of PS exposure (pSIVA) and
L-selectin shedding. (a) Time course of the mean uorescence after IO(2 mM) stimulation over 6 min. IO concomitantly induced PS externalization and loss of L-selectin in WT cells (a,b), but not in Scott patient cells (a,c).
Mean uorescence data in a are presented as means.e.m. from ve independent experiments. Representative pseudocolour plots of normal B cells (b) and Scott patient cells (c) before and 6 min after addition of IO are shown. (d) Fas-antibody (Fas-Ab, 500 ng ml 1, 6 h)-induced apoptosis led to pronounced PS exposure and concomitant L-selectin loss in Scott cells.
0
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 7
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
serine proteinases, iRhom1 and iRhom2 (refs 18,19), and introduction of mutations might affect these processes. However, western blot analyses disclosed that lack of sheddase activity was not due to differences in protein expression or maturation of the ADAM17-3x mutant compared with WT-ADAM17 (Fig. 8e). Flow cytometric analysis revealed comparable cell surface expression of both constructs (Supplementary Fig. 13). These ndings were corroborated by uorogenic peptide substrate assays in COS7 cells demonstrating comparable cell surface-associated peptidolytic activity (Fig. 8f). In particular, these data showed that shedding-incompetent ADAM17-3x retained its enzymatic activity.
DiscussionRemarkably diverse agents rapidly trigger ADAM17-mediated shedding of its substrates from the cell surface. No model exists to explain this perplexing phenomenon. Here we depart from the
conventional view that enhanced sheddase function necessarily derives from a genuine increase in enzymatic activity. Instead, we propose that a nal event common to and essential for all pathways is surface exposure of PS, which relays intracellular signalling events to the ectodomain of ADAM17. Cationic amino acid residues in the MPD then interact with the negatively charged PS-head group, bringing the protease into position for substrate processing (Fig. 9).
At the cytosolic face, PS subserves essential docking functions for enzymes such as Src kinase, MARCKs and PKC, which interact via clusters of cationic amino acids with the negatively charged phospholipid head group43,46. In a related manner, the accessory HIV-1 protein NEF associates with membranes in a biphasic process. A fast proteinlipid interaction driven by electrostatic attraction of a basic amino acid cluster (R_R_RR) to PS is followed by formation of an amphipathic helix that subsequently also becomes membrane bound47.
In the present study, the cationic cluster RK_K located in the MPD of ADAM17 was found to mediate its interaction with and binding to PS-containing membranes. Intriguingly, the ADAM17 stalk region CANDIS (conserved ADAM17 dynamic interaction sequence)48, which follows the MPD onward to the bilayer has recently been found to represent a membrane-interacting amphipathic helix that is also required for sheddase function49. The possible similarities in the mode of membrane interaction between HIV-1 NEF and ADAM17 are striking.
A concept emerges in which ADAM17 is envisaged to basically assume two orientations at the cell surface. In the quiescent state, MPD and CANDIS region are freely oriented in the pericellular space and the protease remains poised at a distance from its targets. Binding of the MPD and CANDIS to the lipid bilayer re-orients the protein, drawing its catalytic domain down to its substrate. Simple spatial considerations then explain why substrate cleavage by ADAM17 regularly occurs close to the membrane surface and on the same cell12. To date, ADAM17-mediated shedding has indeed never been observed in trans.
The proposed model of ADAM17-PS interaction satisfactorily resolves another puzzle relating to the fact that systematic overexpression of the protease does not lead to enhanced shedding activity in vivo50. Should our idea be correct, shedding will be dependent not simply on levels of ADAM17 expression but also on the dynamics of PS exposure. ADAM17 overexpression alone can thus not be simply equated with increased shedding function.
a
HaCaT
PMA
OPS OPC MM
1 5 1 5
10
kDa
44
42
44
42
mM
ERK
10
pERK
b
HUVEC
10
+ PMA + IO + Mel
8
*
TNFR1 shedding
(x-fold increase)
*
6
*
4
#
2
# #
Stimulus
OPS
0 + + + + + + + + +
+ + +
+ + +
OPC
c
COS7 AP-assay
3
*
2
# # #
COS7 peptide substrate
Figure 6 | Direct PS interaction is required for ADAM17 activation.(a) HaCaT keratinocytes were stimulated with PMA (300 ng ml 1) for 30 min and analysed for ADAM17-dependent ERK1/2 activation by western blotting. PMA-induced ERK1/2 phosphorylation was dose dependently reduced by addition of the competing phosphatidylserine head group (OPS) but not by the head group of PC (OPC). Representative western blotting of three independent experiments. (b) HUVECs were stimulated with IO(1 mM, 30 min), PMA (200 ng ml 1, 60 min) or melittin (Mel, 1 mM,60 min) in the presence of OPS (10 mM) or OPC (10 mM) and analysed for the release of soluble TNFR1 by enzyme-linked immunosorbent assay (ELISA) (n 5; s.e.m). (c) COS7 cells transfected with AP-tagged TGF-a
were analysed for IO-induced (1 mM, 30 min) shedding in the presence of OPS (10 mM), metalloprotease inhibitor MM (10 mM) or ADAM17/10 inhibitor (GW, 3 mM) (n 3; s.e.m). (d) COS7 cells were transfected
with ADAM17 and protease cell surface activity was determined by addition of a soluble uorogenic ADAM peptide substrate. Cell surface activity of ADAM17 was abolished in the presence of GW and MM, but not in the presence of OPS (n 3; s.e.m). *A signicant increase compared with
unstimulated cells (Po0.05). #Signicant decrease compared with stimulated cells (Po0.05). Data were analysed by one-way analysis of variance and Bonferroni multiple comparison post hoc test.
TGF--AP activity
(relative increase)
1
0
IO + + + +
OPS GW MM
d
300
Fluorescence (a.u.)
* *
200
#
#
100
0
OPS GW MM
+ADAM17 wild type
8 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
a b c
Open MPD
Closed MPD
ADAM17
MP
0.00
0.00
Dis
(cal s1 )
(cal s1 )
MPD
TM 0.10
10
0.05
0.05
CANDIS
PS
PC
PS
PC
0.10
Cytotail
0 20 30 40
0 20 30 40
10
Time (min)
Time (min)
d
Open MPD
1H15N HSQC
15N TOCSY
HCCCONH
10
50
60
2
116
20
3
118
4
30
15 N (p.p.m.)
1 H (p.p.m.)
13 C (p.p.m.)
120
3 L624
5
6
122
2
7
124
8
8.6 8.4 8.2 8.0 7.8 7.6 7.4 8.4 8.43 8.33
1H (p.p.m.) 1H (p.p.m.) 1H (p.p.m.)
Closed MPD
1H15N HSQC
15 N (p.p.m.)
108
112
116
120
124
128
9.5 6.5
7.5
8.5
1H (p.p.m.)
Figure 7 | The MPD of ADAM17 binds PS. (a) Scheme of ADAM17 structure: metalloprotease domain (MP), disintegrin domain (DIS), MPD, conserved ADAM17 dynamic interaction sequence (CANDIS), transmembrane region (TM) and cytotail. (b) ITC measurements to study the interaction of the open MPD with either PS (green) or PC (red) liposomes. (c) ITC measurements of the PDI-treated closed MPD. The MPD was titrated 20 times into a solution containing either PS (orange) or PC (blue) liposomes. No reaction could be observed. (d) NMR analysis of the open MPD (left panel) and closed MPD (right panel)OPS interaction. Overlay of a close-up of the 1H-15N-HSQC spectra of the MPD conformation in the absence (black) and in the presence (red) of OPS. All resonances of the open conformation (without OPS) appear also in the spectra in the presence of OPS. Four new resonances (arrows) were observed, indicating that the amino acid residues responsible for the OPS binding are located in the exible part of the MPD. The PDI-treated MPD did not show any reaction in the presence of OPS (right panel).
Our study does not address events that regulate maturation and trafcking of ADAM17, but focuses solely on the possible signicance of PS exposure for activity of the sheddase after its positioning at the membrane surface. There, translocation of the anionic phospholipid from the inner to outer leaet is proposed to conclude events leading to execution of shedding function. PS exposure may occur at different sites and with differing kinetics dependent on the cell type and the stimuli, and surface-exposed PS may then act in concert with intracellular events to control the action of the protease or the accessibility of the substrate. In this context, Dang et al.51 have presented evidence that PKC-dependent phosphorylation guides lateral movement of the protease to its substrates in the membrane. Furthermore, Maretzky et al.52 have found that interaction of iRhom1/2 with ADAM17 is sometimes required for triggering sheddase function. Perhaps such processes are responsible for substrate selection and are concluded by PS translocation at the respective sites.
Transient PS exposure in the absence of apoptosis has been described particularly for activated immune cells. Chemotactic
activation of neutrophils leads to cell polarization and to PS exposure at the uropod53, where ADAM17 and L-selectin have also been shown to co-localize in stimulated cells54. It is tempting to speculate that the stimulus-dependent variation in PS exposure we have observed (Fig. 1) bears signicance for the orchestration of sheddase function in general. This open question notwithstanding the idea that substrate selection rests on separate but coordinated events at the outside and inside of the cells obviates the need to postulate the existence of a single regulatory element. With regard to a possible role of PS in also attracting ADAM17 substrates, their large number and diversity render it a priori unlikely that all should have membrane-proximal PS-interacting motifs. Indeed, candidate clusters of cationic amino acid residues are not present in TGF-a.
Transiently occurring PS translocation may subserve a number of previously unsuspected functions in living cells. Pathways leading to PS exposure are intricate and often have not been clearly delineated. Several families of scramblases have been identied that cause breakdown of membrane phospholipid
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 9
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
a
MPD CANDIS
621 631 641 651 661 671
WT -A17
NLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNI
A17-KR
NLFLRKGKPCTVGFCDMNGKCEGGVQDVIERFWDFIDQLSINTFGKFLADNI
Trans-
membrane
domain
A17 3x
NLFLGGGGPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNI
A17 5x
NLFLGGGGPCTVGFCDMNGKCEGGVQDVIERFWDFIDQLSINTFGKFLADNI
b c
MPD-op MPD-3x
20
20
15
15
PS
PC
Control
Average (deg)
10
Average (deg)
10
5
5
0
0
0
2
4 4
Fluor. increase
6 8 10
0
2
6 8 10
Time (min)
Time (min)
d
* *
*
2
8
TGF--AP activity
(relative increase)
1.5
0
* *
6
1
TGF--AP activity
(relative increase)
*
4
0.5
2
PMA + + + + +
IO
Me
0
+
+ +
+ +
+ +
+
+ +
A17-E/A A17-WT A17-KR A17-3x A17-5x
e f
NS
ADAM17
A17
GAPDH
-p
-m
2
3x
kDa
130
100
30
(rel. to untransfected)
1.5
* *
# # #
Mock E/A WT
1
0.5
0
MM
+ +
+
Figure 8 | Deletion of the PS-binding motif prevents MPDPS interaction. (a) Potential PS-binding motifs were exchanged creating MPD and ADAM17 mutants: MPD/ADAM17-3x (R625G/K626G/K628G), ADAM17-KR (K643G/R644G) and the combination of both (ADAM17-5x). (b,c) Binding of the open MPD to CM-dextran/poly-L-lysine (PLL) functionalized sensor chip surface (black) and to immobilized PS membranes (green) or to PC:PS (9:1) membranes (red) in SAW biosensor experiments. Shown is the average phase shift DF of ve individual sensor channels, indicating a mass loading on the surface. (c) Mutation of the RK_K motif in the MPD (MPD-3x) abrogates PS binding. (d) ADAM17/ADAM10 double-decient MEFs were cotransfected with AP-tagged TGF-a (TGF-a-AP) and WT-ADAM17, inactive ADAM17 (A17 E/A) or ADAM17 mutants and either stimulated with PMA (200 ng ml 1)
for 2 h (left panel) or with IO (1 mM) and melittin (Mel, 4 mM) for 30 min (right panel). AP activity in the supernatant was calculated in relation to total (supernatant and cell pellet) AP activity (n 3; s.e.m.). *A signicant increase compared with unstimulated cells (Po0.05). (e) Transfection efciency
was controlled in parallel by western blot analyses (p pro, m mature ADAM17). (f) Overexpression of ADAM17-WT or the ADAM17-3x mutant in
COS7 cells led to similar signicant increases in bona de peptidolytic activity in soluble peptide substrate assays (n 3;s.e.m.; *Po0.05).
Metalloprotease inhibitor MM signicantly reduced this activity (n 3; s.e.m.; #Po0.05). NS, nonsignicant. Data were analysed by one-way analysis of
variance and Bonferroni multiple comparison post hoc test.
asymmetry in nucleated cells. Fortuitously, cells carrying a mutated TMEM16F scramblase from a patient with Scott syndrome were available and provided a valuable tool in the present study. TMEM16F scramblase is activated by intracellular Ca2 . This response is selectively defective in Scott syndrome, while mechanisms for PS externalization provoked via other pathways remain intact. Strikingly, IO simultaneously failed
to provoke PS exposure and L-selectin shedding in Scott lymphocytes. In contrast, both events occurred on induction of apoptosis.
Use of Raji cells demonstrated that the apoptotic process itself cannot activate sheddase activity when there is no PS exposure.
Experiments with PSA-3 cells that are compromised in their PS synthesizing capacity accorded nicely with these ndings. The PS
10 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
Extra-
cellular
signal
Intra-cellular signals
+
+
+
++ +
PS
PS
PS
PS
ADAM17 Substrate
Figure 9 | Model of ADAM17 membrane interaction. External stimuli activate intracellular signalling cascades leading to stimuli and cell-type-specic induction of PS externalization from the inner to the outer cell membrane leaet. Cationic amino acid residues in the MPD of ADAM17 interact with the negatively charged PS head group. The amphipathic a-helical CANDIS could contribute to cell membrane binding, bringing the protease into position for substrate processing.
content of these cells could be normalized simply by culture in the presence of ethanolamine. It thus became possible to quite specically study the inuence of PS on sheddase function. Satisfyingly, cells with reduced PS exposed little PS and this was associated with blunted ADAM17 sheddase activity that returned to normal on PS repletion.
The fact that the close correlation between PS exposure and ADAM17 activation observed with the different stimuli and occurring in different cells should represent mere coincidence appeared highly unlikely. Evidence for an interplay between PS and the protease was subsequently obtained in a series of experiments. First, it was found that addition of soluble OPS but not of OPC to cells countered the shedding process. This occurred in the absence of any direct effect of OPS on peptidolytic activity, as was shown by unaltered cleavage of a soluble peptide substrate. It followed that soluble OPS most probably competed for interaction of the protease with the membrane-exposed phospholipid. The propensity of MPD to bind PS was then decovered and the responsible motif identied. On removal of the PS-binding motif, the mutated protease continued to be expressed in its mature form and exposure at the cell surface was ascertained by ow cytometry and through assessment of cell-associated peptidolytic activity using the uorogenic peptide substrate. The shedding experiments were conducted with ADAM10/ADAM17 double-decient cells to guarantee that any measured sheddase activity derived solely from the transfected enzyme. Despite its ability to cleave the peptide substrate, mutant ADAM17 lacking the PS-binding motif was unable to shed TGF-a.
Further work with a panel of mutants is needed to obtain deeper insight into the events that govern the interaction of ADAM17 with the membrane and with its substrates. It is noteworthy that the amount of PS residing in the extracellular membrane leaet can vary considerably depending on cell population, differentiation and activation status55,56. It will naturally be of interest to investigate whether any of the present ndings extend to ADAM10, the second prominent member of the sheddase family. Regulatory mechanisms that govern the function of this closest homologue to ADAM17 have remained equally elusive in the past.
A critical question is whether the present concept would stand in conict with previous studies that have presented evidence for increased enzymatic activity of ADAM17 in PMA-treated cells. Perhaps, surprisingly, closer inspection of the published data
reveals that they actually accord excellently with our model. PMA-mediated increase in cellular cleavage of peptide substrate reported by Doedens et al.26 rose from basal constitutive levels of 23% to only 56% in stimulated cells within 60 min. The reason for this low increase in net peptide cleavage was revealed in the recent study of Wu et al.57. In elegant single-cell measurements, the authors demonstrated that stimulation of HepG2 cells with 100200 nM PMA resulted in elevated cell-associated protease activity in o5% of the cells over a time span of 36 min. These numbers rose at higher concentrations of the stimulus but still did not exceed 25% at the overtly cytotoxic dose of 1 mM PMA. Given that substantially lower concentrations provoke rapid and maximal substrate shedding of ADAM17 substrates in living cells within minutes4,8, it follows that in the vast majority of cells the shedding process is not associated with or dependent on any genuine increase in protease activity. This conclusion is supported by our present nding that ADAM17-transfected COS7 cells display no alteration in surface-associated protease activity in response to prolonged stimulation with PMA.
A nal conceptual step is now taken. We propose that bona de ADAM17 enzyme activity and sheddase function need to be regarded as separate entities. A mechanistic explanation is provided that assigns a cardinal role of membrane asymmetry in controlling the function of the extracellularly oriented membrane protein. PS exposure can be expected to occur at differing sites and vary in duration and intensity depending on the trigger, cell type and local scramblase machinery. A unique stage could thus be set for the central sheddase of the cell to assume its multifaceted roles in biology.
Methods
Reagents and antibodies. Annexin VFITC, phosphorylserine (OPS), phosphocholine (OPC), PMA, staurosporine, suramin and IO were obtained from Sigma. PS and PC were from Avanti Polar Lipids. Hydroxamate-based ADAM17/ADAM10 inhibitor GW280264 (ref. 58) was purchased from Aeobious. MM and ADAM10 inhibitor GI254023X were purchased from Tocris Bioscience. pSIVA IANBD was from Imgenex Corp. PP2 was from Calbiochem. Z-VAD-FMK and anti-GAPDH (sc-25778, 1:500) were from Santa Cruz Biotechnology. POD-coupled secondary antibodies for immunoblot were from Dianova (705-035-147, 1:10,000). Melittin was synthesized as described59. Open and closed MPD was produced and prepared as described42. The neutralizing ADAM17 antibody D1 (A12) was purchased from AdipoGene Life Sciences (AG-27B-6000PF-C100). Anti-tubulin (E7, 1:500) was from DSHB. Anti-phosphoERK1/2 (4370) and anti-ERK1/2 (4695) were from Cell Signalling (1:3,000). EGFR-blocking antibody Cetuximab (C225) and anti-Fas Antibody CH11 (05-201) were from Merck Millipore. Anti-ADAM17 antibodies used for western blotting (clone 10.1, 1:1,000) and ow cytometric analysis (K133) were described previously60. Additional antibodies used for ow cytometry were as follows: L-selectin (BD Bioscience, DREG56, 559,772, 1:100) and IgG1-APC(BD Bioscience, 554,681, 1:100), rabbit IgG1 control (Southern Biotechnology, 0111-01, 1:100), anti-rabbit Alexa Fluor 488 (Life Technologies, R37118, 1:100) and anti-TNFR1-APC (R&D, FAB225A, 1:100).
Cell culture. HaCaT cells were provided by Dr N.E. Fusenig (DKFZ, Heidelberg, Germany)61. Mouse embryonic broblasts (MEFs) from ADAM10/17 / mice were generated as described below. Human Jurkat T cells and Epstein-Barr virus (EBV)-transformed Raji B cells were purchased from the American Type Tissue Collection (ATCC). MEFs, HaCaT and COS7 cells (ATCC) were grown in high-glucose DMEM (Thermo Fisher Scientic) supplemented with 10% FCS and 1% penicillin/streptomycin (Pen/Strep). HUVEC cells (Provitro) were cultured in endothelial cell growth medium (PromoCell). Epstein-Barr virus (EBV)-transformed B-lymphoblast cell lines from control subjects and a Scott UK patient have been described before62,63. Lymphocytes were grown in RPMI-1640 medium (GIBCO) supplemented with 10% FCS (GIBCO) and Pen/Strep. PSA-3 cells were cultivated in Hams F12 medium supplemented with 10% FCS, 10 mM ethanolamine (Sigma) and 1% Pen/Strep. For PS deprivation, cells were cultured in starvation medium consisting of Hams F12 with 6% dialysed FCS Pen/Strep with
or without 10 mM ethanolamine64.
Expression vectors. The expression vectors for murine WT-ADAM17,inactive ADAM17-E/A mutant were from Dr Gillian Murphy (Cambridge, UK). The plasmid for AP-tagged TGF-a expression was from Dr Carl P. Blobel (Hospital for Special Surgery, New York, USA).
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 11
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
Generation of ADAM17 mutants. Quikchange II site-directed mutagenesis kit (Agilent Technologies) was used according to the manufacturers instructions. The mutations included ADAM17-3x (R625G, K626G and K628G substitutions), ADAM17-KR (K643G and R644G substitutions) and ADAM17-5x (R625G, K626G, K628G, K643G and R644G substitutions). The primer sequences for the ADAM17-3x mutations were 50-gcagagca aaagaacttgtttttggggggaggggggccatgtacagta gggttttgcg-30(fwd), 50-cgc aaaaccctactgtacatggcccccctccccccaaaaacaagttcttttgctctgc-30 (rev) and ADAM17-KR mutations were 50-gacatgaatggcaaatgtgagggag gagtacagga cgtaattgagc-30(fwd), 50-gctcaattacgtcctgtactcctccctcac atttgccattcatgtc-30(rev). Successful mutation was veried by sequencing (Seqlab).
Generation of MPD-3x. Cloning, bacterial expression and purication of the MPD-3x was performed by Trenzmye GmbH. The complementary DNA of human MPD (amino acid residues F581E642 with the following changes: R625G/K626G/ K628G) was cloned into pTZ_E03 expression vector and transformed into Escherichia coli strain Rosetta 2 (DE3). The soluble expressed domain was puried in PBS by its amino-terminal His tag using nickel afnity chromatography.
Transfection and AP-substrate shedding assay. ADAM10/ADAM7 double-decent MEFs were transfected using Turbofect Transfection Reagent (Thermo Fisher Scientic) according to the manufacturers instructions. Twenty-four hours after transfection, cells were washed with DMEM, which was replaced 1 h later by fresh DMEM and treated or not treated with PMA (200 ng ml 1, 2 h) or IO (1 mM, 30 min), or melittin (4 mM, 30 min). Thereafter, supernatants and cell lysates were collected and measured for AP activity at A405 employing the AP substrate 4-nitrophenyl phosphate (Sigma-Aldrich). Shown is the relative AP activity in the supernatant compared with the total AP activity of supernatant plus cell lysates normalized to the unstimulated A17-WT. For shedding assays, the cells were lysed in buffer containing 2.5% Triton-X, 10 mM 1.10-phenanthroline and 1 mM EDTA in water. The metalloprotease inhibitor phenanthroline inhibited autocatalysis of ADAM17 (ref. 65). The expression level of ADAM17 constructs was analysed in parallel by western blot analyses 24 h after transfection.
For AP assay experiments in PSA-3 cells, cells were transfected after 72 h PS deprivation for 6 h in Hams F12 without FCS. Thereafter, medium was changed again to the starvation medium. All AP assays and imaging experiments were performed after 96 h of PS deprivation. As starvation reduced the transfection efciency, the stimulation effect was normalized to the non-treated cells, respectively.
Confocal live-cell imaging. Time-lapse imaging was performed with an inverted confocal microscope (Fluoview FV1000, Olympus) equipped with an environmental chamber using a UPLSAPO 60 oil-immersion objective
(numerical aperture: 1.35) and 2 zoom. Before starting the experiments the
chamber was equilibrated to 37 C in a humidied atmosphere. The cells were seeded in glass-bottom imaging dishes (PAA) and grown to semi-conuence. Cells were allowed to rest for at least 1 h in the microscope stage. Five minutes before acquisition started, PSIVA-IANBD was added to the cells in a nal concentration of 6.25 mg ml 1. PSIVA-IANBD was excited at 488 nm and emission was recorded at 520 nm every 30 or 60 s. Laser and detector settings were the same for each single experiment.
Immunocytochemistry. HaCaTs were seeded on glass coverslips and grown to semi-conuence. After indicated stimulation/inhibition periods, coverslips were immediately incubated with a 1:20 solution of Annexin VFITC in Annexin binding buffer (ABB) for 5 min in the dark at room temperature, washed twice with ABB (10 mM HEPES, 140 mM NaCl and 2.5 mM CaCl2 pH 7.4) and xed for15 min with 3% paraformaldehyde. After xation, coverslips were washed six times with PBS, once with distilled water and mounted in embedding medium. Image acquisition was performed with an inverted confocal microscope (Fluoview FV1000, Olympus) using a UPLSAPO 60 oil-immersion objective (numerical
aperture: 1.35) and 2 zoom. Annexin VFITC was excited at 488 nm and
emission was recorded at 520 nm. Images were acquired with the same laser and detection settings for each experimental setup, but vary between Figs 1 and 2 because of different Annexin VFITC lots.
Image analysis and image statistics. Image analysis was performed with ImageJ1.47 m. Fluorescence area above background uorescence was determined and correlated to the cell growth area. Immunocytochemistry for each group, at least three independent coverslips, each with six to eight images of different areas, were analysed. The mean uorescence area of each coverslip was taken for statistical analysis. Groups were tested by one-way analysis of variance and Bonferroni multiple comparison post hoc test.
Flow cytometric analysis. For analysing ADAM17 cell surface expression, cells were washed with PBS and stained with anti-ADAM17 (K133, 10 mg ml 1) or rabbit IgG-control antibodies (1:100) in 100 ml PBS with 3% BSA for 1 h on ice. After washing, cells were incubated with anti-rabbit Alexa Fluor 488 (1:100) for 30 min on ice. Cells were washed and resuspended in PBS.
Kinetic analysis of PS exposure and L-selectin surface expression was performed by staining cells with APC mouse anti-human L-selectin (BD Bioscience) or mouse IgG1 1:100 in 500 ml RPMI with 1% FCS for 30 min on ice. Thereafter, cells were washed twice and resuspended in 190 ml RPMI. Before commencement of the experiments, cells were warmed to 37 C for 5 min and the media was supplemented with 2 mM CaCl2. pSIVA-IANBD (10 ml) was then added and incubated for 3 min. The samples (20 ml each) were diluted in 500 ml ice-cold ABB and analysed by ow cytometry before and after addition of IO (2 mM) at the indicated time points for a period of 6 min.
Staining after Fas-Ab treatment (6 h Scott cells and WT B cells; 2 h Jurkats and Rajis) was performed as follows: cells were stained with Annexin VFITC (1:100) in ABB for 10 min in the dark at room temperature, washed with ABB and xed for 15 min with 3% paraformaldehyde on ice. Cells were subsequently washed in PBS and stained for 1 h with the corresponding antibody or control at 4 C in PBS with 1% BSA (anti-TNFR-APC or isotype control (Jurkats and Rajis), anti-L-selectin or isotype control (Scott cells and WT B cells). After staining, cells were washed and analysed by ow cytometry with FACSVerse (BD Bioscience). Data were analysed using FlowJo 8.7.3.
Caspase-3 activity assay. Caspase-3 activity was assayed by mixing 50 ml cell lysate (500,000 cells) with 150 ml reaction buffer (100 mM HEPES pH 7.4, 0.1% CHAPS, 10% sucrose, 5 mM dithiothreitol) containing 50 mM of uorogenic caspase-3 substrate (AcDEVDAMC, Enzo Life Science). The mixture was incubated for 60 min at 37 C in an enzyme-linked immunosorbent assay plate and uorescence was measured in the microplate uorometer Twinkle LB 970 (excitation 355 nm, emission 460 nm). Caspase-3 activity was expressed as factor of uorescence increase relative to non-treated cells.
ADAM peptide substrate assay. COS7 cells were transfected in 24-well plates with WT-ADAM17, ADAM17-E/A or ADAM17-3x constructs or with the empty control plasmid (pcDNA3.1). Twenty-four hours after transfection, medium was changed to DMEM with 10 mM uorogenic ADAM substrate (Enzo Life Sciences) and the cells were incubated for the indicated time points. Fluorescence in the supernatant was determined at 485 nm excitation and 530 nm emission.
NMR spectroscopy and LCMS. The 15N- and 13C-isotope-labelled open and closed conformation of the MPD of ADAM17 was prepared as described previously42. NMR measurements were performed on a Bruker Avance 600-MHz spectrometer equipped with a z-gradient triple-resonance cryoprobe. The proteins were dissolved in 10 mM phosphate buffer pH 7.4, 0.01% NaN3 and 7% D2O. OPS was added in a tenfold molar excess. Sequence-specic backbone resonance assignments of the MPD conformers were established using the following spectra: three-dimensional HNCA, HNCO, (H)C(CO)NH, H(CCO)NH, HN(CA)CO, HN(CO)CA, HN(CO)CACB, HNCACB, 15N-edited TOCSY and 13C-edited HCCH-TOCSY. The spectra were acquired at 300 K and referenced to the water resonance at 4.79 p.p.m. All spectra were processed with NMRPipe66 and analysed with NMRViewJ67. LCMS experiments for the determination of MPD-3x disulde bonds were performed as described before42.
Enzyme-linked immunosorbent assay. TGF-a and TNFR1 enzyme-linked immunosorbent assay (both R&D) were performed according to the manufacturers instructions. Cells were grown until conuence in 12-well plates. HaCaTs were stimulated with PMA (300 ng ml 1), IO (1 mM) or melittin (1 mM)
in the presence or absence of MM (10 mM), GI (2 mM) or GW (2 mM) in duplicates for 30 min. HUVECs were stimulated with PMA (200 ng ml 1), IO (1 mM) or melittin (1 mM) in the presence or absence of OPS (10 mM) or OPC (10 mM) in duplicates for 1 h. Supernatants were analysed for soluble shedding products in duplicates.
Western blot analysis. Cells were washed once with PBS and lysed in lysis buffer (5 mM Tris-HCl pH 7.5, 1 mM EGTA, 250 mM saccharose and 1% Triton X-100) supplemented with cOmplete inhibitor cocktail (Roche Applied Science) and10 mM 1,10-phenanthroline monohydrate to prevent ADAM17 autocleavage65. Equal amounts of protein were loaded on 10% SDSPAGE gels. The samples were electrotransferred onto polyvinylidene diuoride membranes (Hybond-P; Amersham) and blocked overnight with 5% skim milk in Tris-buffered saline. After incubation with the indicated antibody in blocking buffer, the membranes were washed three times in TBST (Tris-buffered saline containing 0.1% Tween-20). Primary antibodies were detected using afnity-puried peroxidase (POD)-conjugated secondary antibodies (1:10,000) for 1 h at room temperature. Detection was carried out using the ECL detection system (Amersham). Signals were recorded by a luminescent image analyser (Fusion FX7 imaging system; PEQLAB Biotechnologie). To analyse the expression of pERK1/2 in comparison with total ERK1/2, western blottings were incubated in stripping reagent (100 mM 2-mercaptoethanol, 2% (w/v) SDS, 62.5 mM Tris-HCl pH 6.7) at 55 C for 30 min and re-probed with the exception of the control blot in Fig. 6a. Here, protein
12 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523 ARTICLE
samples were loaded on separate western blottings and probed as indicated. Uncropped scans of the blottings are shown in Supplementary Fig. 14.
Preparation of lipid aggregates/liposomes. Aggregates/liposomes were prepared as 1 mM aqueous dispersions of the phospholipids in buffer (5 mM HEPES and 100 mM KCl pH 7.0) as follows. The lipids were dissolved in chloroform to a concentration of 1 mg ml 1. The solvent was evaporated under a stream of nitrogen, buffer was added and sonicated with a Branson sonicator (Branson Ultrasonics Corporation) for 1 min (1 ml solution). Subsequently, the preparation was cooled for 30 min at 4 C and two times heated for 30 min at60 C and cooled to 4 C. Preparations were stored at 4 C overnight before measurements.
Acoustic wave biochip analyses. Gold-coated chips (S-sens K5 Biosensor Quartz Chips, SAW Instruments GmbH) were functionalized as described68.
A functionalized chip was incubated overnight in ethanol and placed into the reader unit of the S-sens K5 readout system (SAW Instruments GmbH). Biomolecular interaction processes on the surface of the sensor chip can result in changes of phase and amplitude of the surface acoustic wave. Changes of these parameters correlate with mass loading. Measurements were performed at a continuous ow of measuring buffer (5 mM HEPES pH 7.4) of 20 ml min 1 at 22 C. By injection of 100 ml of poly-L-lysine (50 mg ml 1, Fluka), a positively charged layer was formed on top of the negatively charged CMdextran matrix.
One hundred microlitres of phospholipid liposomes (300 mg ml 1) (PS liposomes or PC(9):PS(1) liposomes) were injected and immobilized on the positively ionized surface. The liposomes were dissolved in 150 mM NaCl and 5 mM HEPES pH 7.4, to ensure a homogenous surface coverage. Subsequently, 100 ml of 20 mg ml 1 solutions of the open and closed form of MPD in 5 mM HEPES were injected.
Changes of phase and amplitude induced by the interaction of MPD with the lipid bilayer were recorded over time.
Isothermal titration calorimetry. The binding of the MPD with PC or PS liposomes was analysed by microcalorimetric measurements on an ITC200(GE Healthcare)69. Solutions (0.5 mM) of the open and closed form of MPD in 5 mM HEPES were titrated 20 times in 1.5 ml injections to 250 ml 0.1 mM PS or
PC liposome dispersions. Final lipid:protein ratio was 5:3 (M:M). The enthalpy changes were recorded over time. The heat of dilution were determined in control experiments by injecting peptide solution into buffer (5 mM HEPES, pH 7.4). Measurements were performed at 37 C.
Generation of ADAM10/ADAM17 double-decient mice and cells. ADAM10-decent mice have been described45. To generate ADAM10/ADAM17 double-decient mice, heterozygous ADAM10 / mice were mated with heterozygous
ADAM17-decient mice, which were generated by gene trap as follows. Embryonic stem cell line RST495 with an intronic gene trap insertion between exon 6 and exon 7 of the Adam17 gene were obtained from BayGenomics. The embryonic stem cells were injected into the blastocoel cavity of C57Bl/6J-derived blastocysts and implanted into pseudopregnant females. Chimeric mice generated from the injections transmitted the targeted allele to their progeny. Genotyping was performed by intron spanning ADAM17 PCR 50-tcatcgattttataaatacatgggccg-30(fwd), 50-accctgcattatcccacgacgtgttcc-30(rev) and neomycin PCR 50-gttgtcactgaa gcgggaagggactggctg-30(fwd), 50-gcgaacagttcggctggcgcgagcccctga-30(rev) or b-galactosidase PCR (not shown). Heterozygous ADAM17 / mice were normal and fertile. They were intercrossed to generate homozygous gene-targeted mice.
ADAM17-decient mice showed a comparable phenotype as has been described for mice with deleted ADAM17 Zn2 -binding domain4 including eye, hair and skin defects (Supplementary Fig. 12), and embryonic lethality. MEFs were derived from dissociated E16 embryos and maintained in DMEM supplemented with FCS and antibiotics. Total RNA from MEFs was reverse transcribed and subjected to PCR amplication for Adam17 using the primers 50-gtacgtcgatgcagagcaaa-30(fwd)
and 50-aaaccagaacagacccaacg-30(rev). Actin was used as control (50-gacctctatgcca acacagt-30(fwd) and 50- agtactttgcgctcaggagga-30(rev)). Protein deciency was conrmed by western blotting using anti-ADAM17 ectodomain antibodies (Merck Millipore). Heterozygous ADAM17 / mice were intercrossed with heterozygous
ADAM10 / mice. ADAM10/17 / embryos were evaluated at different stages of development. At day 9 of embryogenesis, embryos presented in a Mendelian frequency (not shown), as evaluated by PCR. No viable ADAM10/17 / embryos were obtained beyond E9. MEFs were derived from dissociated E9 embryos and maintained in DMEM supplemented with FCS and antibiotics. Protein deciency was conrmed by RTPCR (not shown) and western blotting. The functional analysis of these cells is described elsewhere7,22.
Statistical analysis. All values for the ectodomain shedding assays are expressed as means s.e.m. The s.e. values indicate the variation between mean values obtained from at least three independent experiments. Statistics were generated using one-way analysis of variance and Bonferroni multiple comparison post hoc test. P-valueso0.05 were considered statistically signicant (either indicated with * or #).
References
1. Edwards, D. R., Handsley, M. M. & Pennington, C. J. The ADAM metalloproteinases. Mol. Aspects Med. 29, 258289 (2008).
2. Black, R. A. et al. A metalloproteinase disintegrin that releases tumour-necrosis factor-alpha from cells. Nature 385, 729733 (1997).
3. Moss, M. L. et al. Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha. Nature 385, 733736 (1997).
4. Peschon, J. J. et al. An essential role for ectodomain shedding in mammalian development. Science 282, 12811284 (1998).
5. Arribas, J. & Esselens, C. ADAM17 as a therapeutic target in multiple diseases. Curr. Pharm. Des. 15, 23192335 (2009).
6. Wang, Y., Zhang, A. C., Ni, Z., Herrera, A. & Walcheck, B. ADAM17 activity and other mechanisms of soluble L-selectin production during death receptor-induced leukocyte apoptosis. J. Immunol. 184, 44474454 (2010).
7. Le Gall, S. M. et al. ADAMs 10 and 17 represent differentially regulated components of a general shedding machinery for membrane proteins such as transforming growth factor alpha, L-selectin, and tumor necrosis factor alpha. Mol. Biol. Cell 20, 17851794 (2009).
8. Li, Y., Brazzell, J., Herrera, A. & Walcheck, B. ADAM17 deciency by mature neutrophils has differential effects on L-selectin shedding. Blood 108, 22752279 (2006).
9. Reddy, P. et al. Functional analysis of the domain structure of tumor necrosis factor-alpha converting enzyme. J. Biol. Chem. 275, 1460814614 (2000).
10. Bell, J. H., Herrera, A. H., Li, Y. & Walcheck, B. Role of ADAM17 in the ectodomain shedding of TNF-alpha and its receptors by neutrophils and macrophages. J. Leukoc. Biol. 82, 173176 (2007).
11. Saftig, P. & Reiss, K. The A Disintegrin And Metalloproteases ADAM10 and ADAM17: novel drug targets with therapeutic potential? Eur. J. Cell Biol. 90, 527535 (2011).
12. Horiuchi, K. A brief history of tumor necrosis factor alpha--converting enzyme: an overview of ectodomain shedding. Keio J. Med. 62, 2936 (2013).13. Sunnarborg, S. W. et al. Tumor necrosis factor-alpha converting enzyme (TACE) regulates epidermal growth factor receptor ligand availability. J. Biol. Chem. 277, 1283812845 (2002).
14. Sahin, U. et al. Distinct roles for ADAM10 and ADAM17 in ectodomain shedding of six EGFR ligands. J. Cell Biol. 164, 769779 (2004).
15. Blobel, C. P. ADAMs: key components in EGFR signalling and development. Nat. Rev. Mol. Cell Biol. 6, 3243 (2005).
16. Blaydon, D. C. et al. Inammatory skin and bowel disease linked to ADAM17 deletion. N. Engl. J. Med. 365, 15021508 (2011).
17. Bandsma, R. H. et al. Loss of ADAM17 is associated with severe multiorgan dysfunction. Hum. Pathol. 46, 923928 (2015).
18. Adrain, C., Zettl, M., Christova, Y., Taylor, N. & Freeman, M. Tumor necrosis factor signaling requires iRhom2 to promote trafcking and activation of TACE. Science 335, 225228 (2012).
19. McIlwain, D. R. et al. iRhom2 regulation of TACE controls TNF-mediated protection against Listeria and responses to LPS. Science 335, 229232 (2012).
20. Endres, K. et al. Tumor necrosis factor-alpha converting enzyme is processed by proprotein-convertases to its mature form which is degraded upon phorbol ester stimulation. Eur. J. Biochem. 270, 23862393 (2003).
21. Dombernowsky, S. L. et al. The sorting protein PACS-2 promotes ErbB signalling by regulating recycling of the metalloproteinase ADAM17. Nat. Commun. 6, 7518 (2015).
22. Le Gall, S. M. et al. ADAM17 is regulated by a rapid and reversible mechanism that controls access to its catalytic site. J. Cell Sci. 123, 39133922 (2010).
23. Horiuchi, K. et al. Substrate selectivity of epidermal growth factor-receptor ligand sheddases and their regulation by phorbol esters and calcium inux. Mol. Biol. Cell 18, 176188 (2007).
24. Maretzky, T. et al. Migration of growth factor-stimulated epithelial and endothelial cells depends on EGFR transactivation by ADAM17. Nat. Commun. 2, 229 (2011).
25. Sommer, A. et al. Melittin modulates keratinocyte function through P2-receptor-dependent ADAM activation. J. Biol. Chem. 287, 2367823689 (2012).
26. Doedens, J. R., Mahimkar, R. M. & Black, R. A. TACE/ADAM-17 enzymatic activity is increased in response to cellular stimulation. Biochem. Biophys. Res. Commun. 308, 331338 (2003).
27. Chalaris, A. et al. Apoptosis is a natural stimulus of IL6R shedding and contributes to the proinammatory trans-signaling function of neutrophils. Blood 110, 17481755 (2007).
28. Segawa, K. & Nagata, S. an apoptotic eat me signal: phosphatidylserine exposure. Trends Cell Biol. 25, 639650 (2015).
29. Kodigepalli, K. M., Bowers, K., Sharp, A. & Nanjundan, M. Roles and regulation of phospholipid scramblases. FEBS Lett. 589, 314 (2015).
30. Suzuki, J., Umeda, M., Sims, P. J. & Nagata, S. Calcium-dependent phospholipid scrambling by TMEM16F. Nature 468, 834838 (2010).
31. Suzuki, J., Denning, D. P., Imanishi, E., Horvitz, H. R. & Nagata, S. Xk-related protein 8 and CED-8 promote phosphatidylserine exposure in apoptotic cells. Science 341, 403406 (2013).
NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 13
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms11523
32. Elliott, J. I. et al. Membrane phosphatidylserine distribution as a non-apoptotic signalling mechanism in lymphocytes. Nat. Cell Biol. 7, 808816 (2005).
33. de Jong, K., Rettig, M. P., Low, P. S. & Kuypers, F. A. Protein kinase C activation induces phosphatidylserine exposure on red blood cells. Biochemistry 41, 1256212567 (2002).
34. Kim, Y. E., Chen, J., Langen, R. & Chan, J. R. Monitoring apoptosis and neuronal degeneration by real-time detection of phosphatidylserine externalization using a polarity-sensitive indicator of viability and apoptosis. Nat. Protoc. 5, 13961405 (2010).
35. Tape, C. J. et al. Cross-domain inhibition of TACE ectodomain. Proc. Natl Acad. Sci. USA 108, 55785583 (2011).
36. Kuge, O., Nishijima, M. & Akamatsu, Y. Phosphatidylserine biosynthesis in cultured Chinese hamster ovary cells. II. Isolation and characterization of phosphatidylserine auxotrophs. J. Biol. Chem. 261, 57905794 (1986).37. Madge, L. A., Sierra-Honigmann, M. R. & Pober, J. S. Apoptosis-inducing agents cause rapid shedding of tumor necrosis factor receptor 1 (TNFR1).
A nonpharmacological explanation for inhibition of TNF-mediated activation.J. Biol. Chem. 274, 1364313649 (1999).38. Maretzky, T. et al. ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation. Proc. Natl Acad. Sci. USA 102, 91829187 (2005).
39. Fadeel, B. et al. Phosphatidylserine exposure during apoptosis is a cell-type-specic event and does not correlate with plasma membrane phospholipid scramblase expression. Biochem. Biophys. Res. Commun. 266, 504511 (1999).
40. Fadok, V. A., de Cathelineau, A., Daleke, D. L., Henson, P. M. & Bratton, D. L. Loss of phospholipid asymmetry and surface exposure of phosphatidylserine is required for phagocytosis of apoptotic cells by macrophages and broblasts.J. Biol. Chem. 276, 10711077 (2001).41. Castoldi, E., Collins, P. W., Williamson, P. L. & Bevers, E. M. Compound heterozygosity for 2 novel TMEM16F mutations in a patient with Scott syndrome. Blood 117, 43994400 (2011).
42. Dsterhoft, S. et al. Membrane-proximal domain of a disintegrin and metalloprotease-17 represents the putative molecular switch of its shedding activity operated by protein-disulde isomerase. J. Am. Chem. Soc. 135, 57765781 (2013).
43. Lemmon, M. A. Membrane recognition by phospholipid-binding domains. Nat. Rev. Mol. Cell Biol. 9, 99111 (2008).
44. Murray, D., Ben Tal, N., Honig, B. & McLaughlin, S. Electrostatic interaction of myristoylated proteins with membranes: simple physics, complicated biology. Structure 5, 985989 (1997).
45. Hartmann, D. et al. The disintegrin/metalloprotease ADAM 10 is essential for Notch signalling but not for alpha-secretase activity in broblasts. Hum. Mol. Genet. 11, 26152624 (2002).
46. Stace, C. L. & Ktistakis, N. T. Phosphatidic acid- and phosphatidylserine-binding proteins. Biochim. Biophys. Acta 1761, 913926 (2006).
47. Gerlach, H. et al. HIV-1 Nef membrane association depends on charge, curvature, composition and sequence. Nat. Chem. Biol. 6, 4653 (2010).
48. Dsterhft, S. et al. A disintegrin and metalloprotease 17 dynamic interaction sequence, the sweet tooth for the human interleukin 6 receptor. J. Biol. Chem. 289, 1633616348 (2014).
49. Dsterhft, S. et al. Extracellular juxtamembrane segment of ADAM17 interacts with membranes and is essential for its shedding activity. Biochemistry 54, 57915801 (2015).
50. Yoda, M. et al. Systemic overexpression of TNFalpha-converting enzyme does not lead to enhanced shedding activity in vivo. PLoS ONE 8, e54412 (2013).
51. Dang, M. et al. Regulated ADAM17-dependent EGF family ligand release by substrate-selecting signaling pathways. Proc. Natl Acad. Sci. USA 110, 97769781 (2013).
52. Maretzky, T. et al. iRhom2 controls the substrate selectivity of stimulated ADAM17-dependent ectodomain shedding. Proc. Natl Acad. Sci. USA 110, 1143311438 (2013).
53. Frasch, S. C. et al. Phospholipid ip-op and phospholipid scramblase 1 (PLSCR1) co-localize to uropod rafts in formylated Met-Leu-Phe-stimulated neutrophils. J. Biol. Chem. 279, 1762517633 (2004).
54. Schaff, U., Mattila, P. E., Simon, S. I. & Walcheck, B. Neutrophil adhesion to E-selectin under shear promotes the redistribution and co-clustering of ADAM17 and its proteolytic substrate L-selectin. J. Leukoc. Biol. 83, 99105 (2008).
55. Connor, J., Bucana, C., Fidler, I. J. & Schroit, A. J. Differentiation-dependent expression of phosphatidylserine in mammalian plasma membranes: quantitative assessment of outer-leaet lipid by prothrombinase complex formation. Proc. Natl Acad. Sci. USA 86, 31843188 (1989).
56. Rysavy, N. M. et al. Beyond apoptosis: the mechanism and function of phosphatidylserine asymmetry in the membrane of activating mast cells. Bioarchitecture 4, 127137 (2014).
57. Wu, L., Claas, A. M., Sarkar, A., Lauffenburger, D. A. & Han, J. High-throughput protease activity cytometry reveals dose-dependent heterogeneity in PMA-mediated ADAM17 activation. Integr. Biol. (Camb. ) 7, 513524 (2015).
58. Ludwig, A. et al. Metalloproteinase inhibitors for the disintegrin-like metalloproteinases ADAM10 and ADAM17 that differentially block constitutive and phorbol ester-inducible shedding of cell surface molecules. Comb. Chem. High Throughput. Screen 8, 161171 (2005).
59. Andra, J., Koch, M. H., Bartels, R. & Brandenburg, K. Biophysical characterization of endotoxin inactivation by NK-2, an antimicrobial peptide derived from mammalian NK-lysin. Antimicrob. Agents Chemother. 48, 15931599 (2004).
60. Schwarz, J. et al. Polo-like kinase 2, a novel ADAM17 signaling component, regulates tumor necrosis factor alpha ectodomain shedding. J. Biol. Chem. 289, 30803093 (2014).
61. Boukamp, P. et al. Normal keratinization in a spontaneously immortalized aneuploid human keratinocyte cell line. J. Cell Biol. 106, 761771 (1988).
62. Munnix, I. C. et al. Store-mediated calcium entry in the regulation of phosphatidylserine exposure in blood cells from Scott patients. Thromb. Haemost. 89, 687695 (2003).
63. Williamson, P. et al. Phospholipid scramblase activation pathways in lymphocytes. Biochemistry 40, 80658072 (2001).
64. Lee, S. et al. Impaired retrograde membrane trafc through endosomes in a mutant CHO cell defective in phosphatidylserine synthesis. Genes Cells 17, 728736 (2012).
65. Schlondorff, J., Becherer, J. D. & Blobel, C. P. Intracellular maturation and localization of the tumour necrosis factor alpha convertase (TACE). Biochem. J. 347(Pt 1): 131138 (2000).
66. Delaglio, F. et al. NMRPipe: a multidimensional spectral processing system based on UNIX pipes. J. Biomol. NMR 6, 277293 (1995).
67. Johnson, B. A. & Blevins, R. A. NMR view: a computer program for the visualization and analysis of NMR data. J. Biomol. NMR 4, 603614 (1994).
68. Andra, J. et al. Surface acoustic wave biosensor as a tool to study the interaction of antimicrobial peptides with phospholipid and lipopolysaccharide model membranes. Langmuir 24, 91489153 (2008).
69. Brandenburg, K. et al. Temperature dependence of the binding of endotoxins to the polycationic peptides polymyxin B and its nonapeptide. Biophys. J. 88, 18451858 (2005).
Acknowledgements
We thank Dr Edouard M. Bevers (University Maastricht, The Netherlands) for supplying
the lymphocyte cell line. We thank Dr Osamu Kuge (Kyusyu University, Japan) for
providing PSA-3 cells and we thank Dr Yasunori Uchida and Dr Tomohiko Taguchi
(University of Tokyo, Japan) for their support. We thank Dr Gillian Murphy (University
of Cambridge, UK) for kindly providing ADAM17-WT and E/A plasmids and Dr Stefan
Rose-John (University of Kiel, Germany) for providing anti-ADAM17 antibodies. We
thank Dr Carl P. Blobel for discussing the data and critically reading the paper. We thank
Bjrn Ahrens for his excellent technical assistance. We are very thankful to Professor
Alexander Arlt for providing the FACS platform. This work was supported by the
Deutsche Forschungsgemeinschaft, CRC877 (K.R. (A4), J.G.(A6), A.T. (Z2)), the
RTG1743 (K.R. and F.K.) and the Cluster of Excellence Inammation at Interfaces
(K.R., J.G., M.M. (CL-X)). The microscope platform was kindly provided by the CRC877
project Z3.
Author contributions
K.R. conceived the project. K.R. and S.B. designed the experiments. A.S. provided
conceptual input. A.S., F.K., J.B., A.E. and T.M. performed the biological and biochemical
experiments and analysed the data. J.A. produced and provided melittin. S.D. produced
the ADAM17 MPD. M.M., I.L., F.D.S. and J.G. performed and analysed the NMR data.
P.S. and A.T. produced and analysed the MS data. K.K. provided and characterized
the Scott cells. C.N., L.H. and T.G. performed and interpreted the ITC and SAW
experiments. The manuscript was written by K.R. and S.B., and contributed to by
all authors.
Additional information
Supplementary Information accompanies this paper at http://www.nature.com/naturecommunications
Web End =http://www.nature.com/
http://www.nature.com/naturecommunications
Web End =naturecommunications Competing nancial interests: The authors declare no competing nancial interests. Reprints and permission information is available online at http://npg.nature.com/reprintsandpermissions/
Web End =http://npg.nature.com/
http://npg.nature.com/reprintsandpermissions/
Web End =reprintsandpermissions/
How to cite this article: Sommer, A. et al. Phosphatidylserine exposure is required for
ADAM17 sheddase function. Nat. Commun. 7:11523 doi: 10.1038/ncomms11523 (2016).
This work is licensed under a Creative Commons Attribution 4.0
International License. The images or other third party material in this
article are included in the articles Creative Commons license, unless indicated otherwise
in the credit line; if the material is not included under the Creative Commons license,
users will need to obtain permission from the license holder to reproduce the material.
To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
Web End =http://creativecommons.org/licenses/by/4.0/
14 NATURE COMMUNICATIONS | 7:11523 | DOI: 10.1038/ncomms11523 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
Copyright Nature Publishing Group May 2016
Abstract
ADAM17, a prominent member of the 'Disintegrin and Metalloproteinase' (ADAM) family, controls vital cellular functions through cleavage of transmembrane substrates. Here we present evidence that surface exposure of phosphatidylserine (PS) is pivotal for ADAM17 to exert sheddase activity. PS exposure is tightly coupled to substrate shedding provoked by diverse ADAM17 activators. PS dependency is demonstrated in the following: (a) in Raji cells undergoing apoptosis; (b) in mutant PSA-3 cells with manipulatable PS content; and (c) in Scott syndrome lymphocytes genetically defunct in their capacity to externalize PS in response to intracellular Ca2+ elevation. Soluble phosphorylserine but not phosphorylcholine inhibits substrate cleavage. The isolated membrane proximal domain (MPD) of ADAM17 binds to PS but not to phosphatidylcholine liposomes. A cationic PS-binding motif is identified in this domain, replacement of which abrogates liposome-binding and renders the protease incapable of cleaving its substrates in cells. We speculate that surface-exposed PS directs the protease to its targets where it then executes its shedding function.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer




