ARTICLE
Received 25 Mar 2016 | Accepted 20 Oct 2016 | Published 5 Dec 2016
Emeline Bon1, Virginie Driffort1, Frdric Gradek1, Carlos Martinez-Caceres2, Monique Anchelin3, Pablo Pelegrin2, Maria-Luisa Cayuela3, Sverine Marionneau-Lambot4, Thibauld Oullier4, Roseline Guibon1,5, Galle Fromont1,5, Jorge L. Gutierrez-Pajares1, Isabelle Domingo1, Eric Piver5,6, Alain Moreau6, Julien Burlaud-Gaillard7,Philippe G. Frank1, Stphan Chevalier1,8,*, Pierre Besson1,8,* & Sbastien Roger1,9,10,*
The development of metastases largely relies on the capacity of cancer cells to invade extracellular matrices (ECM) using two invasion modes termed mesenchymal and amoeboid, with possible transitions between these modes. Here we show that the SCN4B gene, encoding for the b4 protein, initially characterized as an auxiliary subunit of voltage-gated sodium channels (NaV) in excitable tissues, is expressed in normal epithelial cells and that reduced b4 protein levels in breast cancer biopsies correlate with high-grade primary and metastatic tumours. In cancer cells, reducing b4 expression increases RhoA activity, potentiates cell migration and invasiveness, primary tumour growth and metastatic spreading, by promoting the acquisition of an amoeboidmesenchymal hybrid phenotype. This hyperactivated migration is independent of NaV and is prevented by overexpression of the intracellular C-terminus of b4. Conversely, SCN4B overexpression reduces cancer cell invasiveness and tumour progression, indicating that SCN4B/b4 represents a metastasis-suppressor gene.
1 Inserm UMR1069, Nutrition, Croissance et Cancer, Universit Franois-Rabelais de Tours, 10 Boulevard Tonnell, 37032 Tours, France. 2 Inammation and Experimental Surgery Unit, CIBERehd, Murcias BioHealth Research Institute IMIB-Arrixaca, Clinical University Hospital Virgen de la Arrixaca, E-30120 Murcia, Spain. 3 Telomerase, Cancer and Aging Group, Hospital Virgen de la Arrixaca, E-30120 Murcia, Spain. 4 Cancrople du Grand Ouest, Plateforme In Vivo, 44000 Nantes, France. 5 CHRU de Tours, 2 Boulevard Tonnell, 37000 Tours, France. 6 Inserm, U966, Universit Franois-Rabelais de Tours,10 Boulevard Tonnell, 37032 Tours, France. 7 Laboratoire de Biologie Cellulaire-Microscopie Electronique, Facult de Mdecine, Universit Franois-Rabelais de Tours, 2 Boulevard Tonnell, 37000 Tours, France. 8 UFR Sciences Pharmaceutiques, Universit Franois-Rabelais de Tours, 31 Avenue Monge, 37200 Tours, France. 9 UFR Sciences et Techniques, Dpartement de Physiologie Animale, Universit Franois-Rabelais de Tours, Parc de Grandmont, 37200 Tours, France. 10 Institut Universitaire de France, 1, Rue Descartes, 75231 Paris Cedex 05, France. * These authors contributed equally to this work. Correspondence and requests for materials should be addressed to S.R. (email: mailto:[email protected]
Web End [email protected] ).
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 1
DOI: 10.1038/ncomms13648 OPEN
SCN4B acts as a metastasis-suppressor gene preventing hyperactivation of cell migration in breast cancer
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
The acquisitions of extensive invasion potencies by cancer cells are key components in the metastatic cascade, hence in patients survival1,2. During the last decade, important
knowledge in various processes of cancer cell migration and invasiveness has emerged3. In the mesenchymal mode, engaged cells harbour an elongated broblast-like morphology, with a rear-to-front lamellopodial cell polarity, and generate a path in the extracellular matrix (ECM) through proteolytic remodelling. This is performed by invadosomal structures, which are F-actin-rich organelles, protrusive into the ECM and responsible for its proteolysis through the recruitment of both membrane-associated and extracellularly released soluble proteases4,5. In the other invasive mode, called amoeboid, cancer cells show no obvious polarity but a rounded morphology, and display high potentials for migration and invasiveness6. In this case, strong actomyosin contractions propel the cell, which deforms and squeezes inside small gaps of the ECM, with no need to degrade it. While different cancer cell types may preferentially engage into the mesenchymal mode or the amoeboid one, the most aggressive cancer cells show high plasticity and are able to switch from one phenotype to the other6. Such transitions, orchestrated by RhoGTPases family members79, offer selective advantages and compensatory mechanisms to migrating cancer cells, presumably abrogating the efcacy of anticancer treatments10. Indeed, attempts to reduce cancer cell invasiveness and metastatic dissemination by targeting proteolytic activity and ECM remodelling have largely failed because of the adaptive compensatory mechanism sustaining protease-independent processes11.
Voltage-gated sodium channels (NaV) are composed of one large pore-forming principal subunit (nine genes encoding nine proteins, NaV1.11.9)12,13 and one or two smaller transmembrane subunits considered as auxiliary (four genes SCN1B to SCN4B, generating four subunits, b1 to b4)14. The activity of NaV gives rise to Na currents (INa) generating action potentials in excitable cells such as neurons, skeletal and cardiac muscle cells. As a result, these proteins have been considered hallmarks of excitable cells. However, multiple studies have recently demonstrated their expression in non-excitable cells, in which they regulate cellular functions such as migration, differentiation, endosome acidication, phagocytosis and podosome formation15. In addition, NaV are abnormally expressed in carcinoma cells and tumour biopsies, and their activity is associated with aggressive features and cancer progression1618. Expression of the NaV1.5 isoform in breast tumours is correlated with metastases development and patients death19,20. In highly aggressive human breast cancer cells, the activity of pore-forming NaV1.5 is not associated with cell excitability but with ECM degradation and cancer cell invasiveness21, hence favouring metastases development22,23. NaV1.5-dependent invasiveness is mediated through allosteric modulation of the Na H exchanger NHE1, subsequent acidication of the pericellular microenvironment and activation of extracellular acidic cysteine cathepsins2426. Furthermore, NaV1.5 sustains Src kinase activity, polymerization of actin and acquisition by cells of a spindle-shaped elongated morphology26. Altogether, these results indicate a critical role for NaV1.5 in mesenchymal invasion. The participation of non-pore-forming SCNxB/b subunits in oncogenic processes was not studied as extensively, with the exception of the b1 subunit27, and their roles during metastatic progression remain largely unknown.
In this study, we show that the SCN4B/b4 subunit is expressed in normal epithelial cells and tissues, but is strongly down-regulated in aggressive cancer cells and tumours. The loss of SCN4B/b4 enhances cancer cell migration and metastases
formation through a RhoA-dependent signalling pathway, independently of pore-forming NaV subunits.
ResultsAssociation with poor prognosis. Expression of the b4 protein, encoded by the SCN4B gene28, has mostly been studied in excitable cells in which mutations have been linked to sodium channelopathies29,30. Initial immunohistochemical analyses performed in normal and cancer breast tissues indicated that the SCN4B/b4 protein was specically expressed in epithelial cells from normal mammary acini, but was signicantly downregulated in cancer cells (Fig. 1a,b). Levels of b4 expression were analysed by immunohistochemistry on tissue microarrays containing normal breast, hyperplasic, dysplasia, breast cancer and lymph node metastases (LNM) samples. Again, the expression of SCN4B/b4 was strong in epithelial cells from normal non-excitable mammary tissues (Fig. 2a,b), as well as in breast hyperplasia (Supplementary Fig. 1). Levels of SCN4B/b4 expression in mammary hyperplasia and dysplasia were similar to those recorded in normal mammary tissues, but were remarkably reduced in biopsies of mammary carcinomas. The most important reductions in SCN4B/b4 expression were observed when comparing in situ grade I to invasive grade II breast
a
Normal breast
Breast cancer
b
Figure 1 | SCN4B/b4 protein is expressed in normal epithelial cells of human breast tissues and is downregulated in cancer cells.
(a,b) b4 protein (expression of the SCN4B gene) was analysed by immunohistochemistry on human breast tissue samples. (a) The expression of b4 protein was strong in epithelial cells of mammary acini (some examples are indicated by the black arrows), and not in non-epithelial cells of normal breast tissues. (b) In breast cancer tissue, the expression of b4 protein was strong in normal epithelial cells of mammary acini (black arrows), but signicantly reduced in cancer cells (tumour area indicated by the red arrow, T). Scale bars, 50 mm.
2 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
Strong staining Weak staining
No staining
a
***
b
***
Lobular carcinoma
Normal breast Ductal carcinoma
Hyperplasia Dysplasia
Breast cancer
(11)
(31) (165)
100
75
% of samples
50
25
50 m
0
Normal
breast
Hyperplasia or dysplasia
Cancer
(mixed grades)
c d Ductal carcinoma grade I
Ductal carcinoma grade II
***
Ductal carcinoma grade III
***
***
(26)
(96)
(26)
(50)
100
75
% of samples
50
25
0 Grade I
50 m
Grade II Grade III LNM
e
f
g
12.5
SCN4B KaplanMeier survival estimates
Probability of MR-free survival
1.0
0.0
0 2 4 6 8 10 0 2 4 6 8 10
SCN4B expression levels
(RPKM)
1.0
0.0
10.0
0.8
0.8
7.5
0.6
0.6
5.0
0.4
0.4
2.5
0.2
SCN4B > median
SCN4B median
P -value= 0.0005
0.2
SCN4B > median
SCN4B median
P -value= 0.0013
0.0
Non-cancer
*** SCN4B KaplanMeier survival estimates
Probability of AE-free survival
Cancer
Time (years)
Time (years)
Figure 2 | SCN4B down regulation in human breast cancer tissues associates with poor prognosis. (ad) SCN4B/b4 protein expression was analysed by immunohistochemistry on breast tissue microarrays. Samples were stratied in no staining, weak staining or strong staining groups. (a) Proportion of samples showing no (white), weak (gray) or strong (black) b4 staining in normal breast, compared with mammary hyperplasia/dysplasia and cancer (mixed grades) samples. The number of samples per condition is indicated in brackets. SCN4B/b4 protein staining was stronger in normal compared with cancer samples (w2, Po0.001), and in hyperplasia/dysplasia compared with cancer samples (w2, Po0.001). (b) SCN4B/b4 staining from indicated samples. Scale bars, 50 mm. (c) Proportion of samples showing no, weak or strong SCN4B/b4 staining in cancer samples, from grade I to III, and in lymph node metastases (LNM) samples. The number of samples per condition is indicated in brackets. b4 staining was stronger in grade I cancer samples compared with more advanced cancer samples (grades II, III and LNM) (w2, Po0.001). (d) Representative pictures of b4 staining from grade I, II and III ductal carcinoma samples. Scale bars, 50 mm. (e) Expression of the SCN4B gene in non-cancer (n 29) and in invasive breast carcinoma tissues (n 145)
was analysed from The Cancer Genome Atlas (TCGA). RNA level is expressed as reads per kilobase per million (RPKM). Box plots indicate the rst quartile, the median and the third quartile; whiskers indicate minimum and maximum values; squares show the means. SCN4B gene was signicantly downregulated in cancer tissues (MannWhitney rank sum test, MW, Po0.001). (f,g) Prognostic analyses of gene expression in breast cancers, performed using the Breast Cancer Gene-Expression Miner. (f) KaplanMeier Any Event (AE)-free survival analyses, performed on data pooled from cohorts for the expression of SCN4B gene (n 1,024 patients). AE is dened as being metastatic relapse (MR) or patient death. A weak expression of SCN4B gene
(r median of the pooled cohorts) was associated with a decrease in the AE-free survival (P 0.0005). (g) KaplanMeier MR-free survival analyses were
performed for the expression of SCN4B (n 661 patients). A weak expression of SCN4B (r median of the pooled cohorts) was associated with a decrease
in the MR-free survival (P 0.0013). Cox results are displayed on the graph.
tumours. SCN4B/b4 protein was weakly expressed or totally absent in most grade II and III primary tumours studied, as well as in LNM (Fig. 2c,d). Lower levels of the SCN4B gene transcript in breast cancer tissues, compared with non-cancer tissues, were also found to be highly signicant in RNA sequence expression analysed from The Cancer Genome Atlas Network (Fig. 2e) and to be associated with an increased risk of metastatic relapse or death in breast cancer patients (Fig. 2f,g). Levels of expression of
the other SCNxB genes were also assessed. Expressions of SCN1B, SCN2B and SCN3B were lower in cancer compared with non-cancer tissues (Supplementary Fig. 2a,c,e). However, there was no association between the levels of expression of these genes and the risk of metastatic relapse (Supplementary Fig. 2b,d and f). Importantly, SCN1B and SCN4B genes appeared to be the two most highly expressed SCNxB genes in non-cancer tissues (Supplementary Fig. 2g). Furthermore, SCN4B seemed to be the
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 3
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
most signicantly downregulated SCNxB gene in breast cancer tissues compared with non-cancer tissues (Supplementary Fig. 2h). Similarly, the analysis of data from two published studies31,32 showed that SCN4B expression levels were downregulated in lung cancer compared with normal lung tissues (Supplementary Fig. 3a,b) and our immunohistochemical analyses in lung cancer tissue microarrays also identied a tendency for decreased protein expression in high-grade primary lung tumours and metastases (Supplementary Fig. 3c,d). SCN4B expression was also down-regulated in prostate, colon and rectal cancers compared with normal tissues (Supplementary Fig. 3e,g). This suggests that SCN4B/b4 is normally expressed in normal epithelial cells (also conrmed by immunohistochemical analyses of normal oesophagus (Supplementary Fig. 4) and that its loss of expression is associated with a gain in invasive properties by cancer cells and an aggressive progression of epithelial tumours. Correlatively, we found that SCN4B expression was higher in non-cancer epithelial mammary MCF-10A compared with several breast cancer cell lines such as MCF-7, MDA-MB-468, MDA-MB-435s and MDA-MB-231 (Fig. 3a,b). Particularly, the expression level of SCN4B was low in the highly invasive and metastatic MDA-MB-231 breast cancer cells, known to express functional NaV1.5 (ref. 22). SCN4B mRNA (Fig. 3c) and protein (Fig. 3d)
were expressed in MDA-MB-231 cells genetically modied with the luciferase gene (MDA-MB-231-Luc cells). SCN1B/b1 and
SCN2B/b2 were also expressed, but not SCN3B/b3. The lack of expression of SCN3B/b3 was further demonstrated in conventional PCR using two different couples of primers (Supplementary Fig. 5a), thus conrming previously published results obtained with wild-type cells24,33. Transient silencing of SCNxB genes using specic small-interfering RNA (siRNA: siSCN1B, siSCN2B or siSCN4B) was responsible for signicant (6580%) decreases in protein levels 48 h after transfection, as compared with a control null-target siRNA (siCTL) (Fig. 3e). The downregulation of one of the SCNxB gene had no effect on the mRNA expression of the others, suggesting the absence of compensation between SCNxB/b subunits in these conditions (Supplementary Fig. 5b). While reduced expression of either SCN1B/b1 or SCN2B/b2 decreased cancer cell invasiveness through Matrigel-coated invasion chambers by 42.86.6% (n 8) and 51.70.3% (n 8) (means.e.m. (number of
independent experiments)), respectively, inhibition of SCN4B expression enhanced invasiveness by 62.412.2% (n 8)
(Fig. 3f,g). We also analysed the consequences of knocking-down the expression of SCN4B on MDA-MB-231-Luc invasiveness in vivo using the zebrash model of micrometastasis34,35. Sixty-one per cent of zebrash embryos injected with siCTL cells had their organs colonized. This number was increased to approximately 87% of the embryos presenting micrometastases when injected with siSCN4B cells, resulting in an increase in the zebrash colonization index by 1.410.08 fold (n 3) (Fig. 3h,i). These quantications were performed 72 h
after siRNA transfection, a time for which SCN4B downregulation was still efcient (Supplementary Fig. 6a).
Independence of pore-forming NaV subunits. Breast cancer cell invasiveness has been demonstrated to be strongly regulated by the activity of the pore-forming NaV1.5 (refs 19,20,24). Therefore, we initially hypothesized that loss of SCN4B expression would increase NaV1.5 activity in highly aggressive cancer cells. To test this hypothesis, we generated MDA-MB-231-Luc-derived cell lines stably expressing a null-target small hairpin RNA (shCTL cells), or expressing shRNAs targeting either the expression of SCN5A gene encoding for NaV1.5 (shSCN5A cells, in which the
expression of the SCN4B gene is not changed) as previously described22 or targeting SCN4B transcripts (shSCN4B cells). The use of shSCN4B resulted in 81.10.2% (n 37) decrease in
mRNA levels (Supplementary Fig. 6b) with no effect on the expression of the other SCNxB subunits (Supplementary Fig. 6d,e). The three cell lines generated displayed identical viability and growth properties (Supplementary Fig. 6c). In shCTL cells, INa is known to be generated by the sole NaV1.5 isoform which, while commonly referred to as tetrodotoxin (TTX)-resistant, can almost completely be inhibited by 30 mM
TTX22,36. Similarly to already reported results24,37, the inhibition of NaV1.5 sodium currents in shCTL cells using 30 mM TTX reduced invasiveness by 45.34.3% (n 8), similar to the
reduction in invasiveness (43.45.1%, n 6) in shSCN5A cells,
not expressing NaV1.5 and which were no longer sensitive to the addition of TTX (Fig. 4a). Knocking-down the expression of the SCN4B gene with different interfering RNA sequences resulted in similar potentiations of aggressiveness (shSCN4B, Fig. 4a and siSCN4B; Fig. 3e,f). ShSCN4B cell invasiveness was 281.816.2% (n 16) higher than that of shCTL cells. The treatment of
shSCN4B cells with 30 mM TTX, a concentration that inhibits all NaV channels, with the exception of the very TTX-resistant NaV1.8, signicantly reduce their invasiveness (Fig. 4a). To assess a possible independence from NaV1.5 in the increased invasiveness mediated by the loss of SCN4B expression, we silenced SCN5A expression in shSCN4B cells. This signicantly reduced cancer cell invasiveness, which was still 184.327.0% (n 12) of shCTL cells (Fig. 4b). We then transiently inhibited
the expression of SCN4B using siSCN4B siRNA in shSCN5A cells, which no longer express NaV1.5. These cells were also treated or not with (i) 3 mM TTX which inhibits all TTX-sensitive channels (NaV1.11.4 and NaV1.61.7) or (ii) 30 mM TTX to also inhibit NaV1.5 and NaV1.9 TTX-resistant channels, or (iii) with 30 nM of the specic NaV1.8 inhibitor A80346738. As shown in Fig. 4c, silencing SCN4B expression with siSCN4B in shSCN5A cells increased invasiveness ( 251.720.8%, n 6) similarly to what
was observed with shSCN4B cells expressing NaV1.5 (Fig. 4a). Furthermore, neither TTX nor A803467 reduced invasiveness of shSCN5A cells transfected with siCTL or siSCN4B (Fig. 4c). Altogether, these data clearly demonstrate that the increased invasiveness of SCN4B gene-suppressed cells was not a consequence of the upregulation of NaV1.5 or of any other
NaV. We also assessed the effect of knocking-down the expression of SCN4B, using siRNA, on the invasive properties of cancer cell lines, such as the non-small-cell human lung cancer H460 or the human prostate cancer PC3 cell lines, known to express functional NaV (NaV ) contributing to mesenchymal invasion.
In addition, we used cancer cell lines that do not express NaV (NaV ) such as the less invasive human breast MDA-MB-468 and the non-small-cell lung A549 cancer cell lines21,39,40. In all cancer cell lines tested, showing similar levels of SCN4B expression (Supplementary Fig. 5d), transfection of siSCN4B signicantly increased the invasiveness, from 23.78.3% (n 3) increase for
PC3 cells up to 60.99.5% (n 12) increase in A549 cells
(Fig. 4d), conrming that SCN4B/b4 loss potentiates invasiveness independently of the pore-forming NaV subunit.
Because NaV1.5 has been reported as an important regulator of mesenchymal invasion in breast cancer cells through the potentiation of NHE1-dependent H efux and ECM degradation22,25,26, we further investigated its regulation in shSCN4B cells. Patch-clamp recordings revealed, contrary to our initial assumptions, that the loss of SCN4B expression signicantly decreased the maximal peak INa, as observed in the
INavoltage relationship (Fig. 5a), suggesting a reduction of channel density at the plasma membrane. This could be due to the reduction of SCN5A expression levels as observed by
4 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
a b
MCF10A
MCF7
18
Relative mRNA expression (1,000)
MDA-MB-468
MDA-MB-435s
MDA-MB-231
2.0
MW
(kDa)
75
16
SCN4B/4 protein expression
(relative to HSC70)
14
25
1.5
4 HSC70
12
10
8
1.0
6
* *
*
4
0.5
*
*
2
*
*
0
*
0.0
MCF10A
MCF7
MDA-MB-468
MDA-MB-435s
MDA-MB-231
MCF10A
MCF7
MDA-MB-468
MDA-MB-435s
MDA-MB-231
Non-cancer cells Breast cancer cells
Non-cancer cells Breast cancer cells
c d
1 2 4
MDA-MB-231
300 bp
200 bp
100 bp
300 bp
200 bp
100 bp
MW (kDa)
50
25
37
SCN1B
SCN2B
SCN3B
SCN4B
proteins
Positive control of primers
75 HSC70
e
h
siCTL
siSCN1B
siCTL
siSCN2B
siCTL
siSCN4B
MW (kDa)
25
37
75
50
1
50
2
4
HSC70
HSC70
37
75
50
HSC70
25
75
50
f
siSCN1B
siCTL siSCN2B siSCN4B
g
1.8 ***
***
i
1.6
Cancer cell invasiveness
(relative to siCTL condition)
1.6
(283)
1.4
Zebrafish colonization index
(relative to siCTL condition)
**
1.4
1.2
1.2
1.0
(252)
1.0
0.8
0.8
***
0.6
0.6
0.4
0.4
0.0
0.2
siCTL siSCN1B siSCN2B siSCN4B
0.0 siCTL siSCN4B
Figure 3 | Expression of the SCN4B/b4gene in human breast cancer cell lines and contribution to cancer cell invasiveness. (a) The expression of SCN4B gene was studied by RTqPCR in human mammary epithelial non-cancer MCF-10A and cancer MCF7, MDA-MB-468, MDA-MB-435s and MDA-MB-231 cell lines. Results are expressed as relative to that of HPRT-1 gene (n 712) and presented as mean valuess.e.m. *, signicantly different from MCF-10A
at Po0.05 (MW). (b) The expression of SCN4B/b4 protein was studied by densitometric analysis of western blot experiments in same cells as in a. Results are given as the amount of SCN4B/b4 protein relative to that of HSC70 (n 5) and presented as mean valuess.e.m. *, signicantly different from
MCF-10A at Po0.05 (MW). The image on top shows a representative western blotting experiment. (c) The expression of SCNxB genes was analysed in MDA-MB-231-Luc cells by reverse transcriptionPCR. Plasmids encoding human SCNxB genes were used as positive controls for PCR primers.
(d) Representative western blotting experiments showing protein expression for b1 (SCN1B), b2 (SCN2B) and b4 (SCN4B) in MDA-MB-231-Luc cells. (e) Cells were transfected with scrambled siRNA (siCTL) or with siRNA directed against the expression of the SCN1B gene (siSCN1B), the SCN2B gene (siSCN2B) or the SCN4B gene (siSCN4B). The efcacy of siRNA transfection was assessed by western blotting experiments 48 h after transfection. HSC70 was used as a control for sample loading. (f) Representative images of xed and haematoxylin-stained MDA-MB-231-Luc cells on invasion inserts. Cancer cells were transfected with scrambled siCTL or with specic siRNA. Scale bars, 50 mm. (g) Summary of cancer cell invasiveness results (n 8) for
MDA-MB-231-Luc cells transfected with siCTL or siSCNxB. Results were expressed relative to siCTL and presented as mean valuess.e.m. ***, statistically different from siCTL at Po0.001 (Students t-test). (h) Representative image of a zebrash embryo injected in the yolk sac with MDA-MB-231-Luc cells stained with CM-Dil and showing sites of colonization. Scale bars, 500 mm. Below is a magnication of the highlighted region containing human cancer cells (see arrows) colonizing organs of the embryo. (i) Zebrash colonization index of siCTL or siSCN4B cells. Numbers in brackets indicate the number of embryos examined for each condition, from three different experiments. Results are presented as mean valuess.e.m. **, statistically different from siCTL at Po0.01 (Students t-test).
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 5
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
a b
#
#
3.0
3.5
***
***
3.0
Cancer cell invasiveness
(relative to shCTL condition)
2.5
Cancer cell invasiveness
(relative to shCTL+ siCTL)
2.5
2.0
***
2.0
1.5
NS
1.5
1.0
*** *** ***
***
1.0
0.5
0.5
0.0
TTX (30 M)
+ + +
0.0
siCTL
shCTL
sh SCN5A shSCN4B
siCTL siSCN5A
shSCN4B
shCTL
c d
NS
3.0
*** ***
***
***
1.8
2.5
shSCN5Acancer cell invasiveness
(relative to shSCN5A+ siCTL)
***
* *
NaV NaV NaV+
NaV+
1.6
***
Cancer cell invasiveness
(relative to siCTL condition)
2.0
1.4
1.2
1.5
NS
siCTL
1.0
0.8
1.0
0.6
0.5
0.4
0.2
0.0
3 30
+
3 30
+
siSCN4B
0.0
TTX (M)
A803467 (30 nM)
siCTL
MDA-MB-
468
H460
A549
PC3
Figure 4 | Loss of SCN4B/b4 expression promotes human cancer cell invasiveness independently of the pore-forming NaV subunit. (a) Cancer cell invasiveness was assessed, using Matrigel-invasion chambers, from MDA-MB-231-Luc cells stably transfected with null-target shRNA (shCTL), SCN5A-targeting shRNA (shSCN5A) or SCN4B-targeting shRNA (shSCN4B), in the absence ( ) or presence ( ) of 30 mM TTX. The results from 8 to 16
independent experiments were expressed relative to control cells transfected with shCTL in the absence of TTX. ***, statistically different from shCTL at Po0.001 and #, statistically different from shSCN4B in the absence of TTX at Po0.05. (b) Cancer cell invasiveness was likewise assessed in shCTL or shSCN4B cells, transiently transfected with null-target siRNA (siCTL) or SCN5A-targeting siRNA (siSCN5A). The results from 12 independent experiments were expressed relative to shCTL cells transfected with siCTL. ***, statistically different from the shCTL/siCTL condition at Po0.001 and #, statistically different from shSCN4B/siCTL at Po0.05. (c) Cancer cell invasiveness was assessed in MDA-MB-231-Luc cells stably expressing the SCN5A-targeting shRNA (shSCN5A), not expressing the NaV1.5 protein, and transiently transfected with null-target siRNA (siCTL) or SCN4B-targeting siRNA (siSCN4B). This effect was assessed in the absence ( ) or presence ( ) of two TTX concentrations (3 or 30 mM), or 30 nM of the NaV1.8 inhibitor A803467. The results
from six independent experiments were expressed relative to shSCN5A cells transfected with siCTL, in the absence of any NaV inhibitor. NS stands for no statistical difference and *** denotes a statistical difference from shSCN5A/siCTL at Po0.001. (d) Cancer cell invasiveness was assessed using Matrigel-invasion chambers for MDA-MB-468 breast, H460 and A549 non-small-cell lung, and PC3 prostate cancer cells transfected with null-target siRNA (siCTL, black bar) or SCN4B-targeting siRNA (siSCN4B, red bars). Cancer cell lines known to express or not functional NaV channels are indicated as NaV and NaV , respectively. The results from 3 to 12 independent experiments were presented and are expressed relative to the results obtained with the same cells transfected with siCTL. *, different from siCTL at Po0.05 and *** at Po0.001. Statistics presented in this gure were performed using ANOVA for multiple group comparison (ac) or Students t-test (d). All results presented in this gure are mean valuess.e.m.
quantitative PCR (qPCR) (Supplementary Fig. 6d). In shSCN4B cells, the INa activationvoltage relationship was slightly depolarized as compared with shCTL cells (V1/2activation were 37.20.9 mV (n 22) and 40.11.0 mV (n 18),
respectively, P 0.037, Students t-test). More importantly, the
availabilityvoltage relationship was also signicantly shifted to a more depolarized potential in shSCN4B cells compared with shCTL cells (V1/2availability were 80.61.6 mV (n 22) and 86.31.6 mV (n 18), respectively, P 0.016, Students t-test;
Fig. 5b), suggesting that even though there were less NaV1.5 channels at the plasma membrane, they might be more active at the membrane potential of cancer cells (comprised between 30
and 40 mV) through an increased persistent window current.
Indeed, while the peak INa was reduced in shSCN4B cells, the persistent INa recorded for a membrane depolarization from
100 to 30 mV was strictly identical (Fig. 5c,d). Therefore, the
ratio INa persistent/INa peak was signicantly enhanced in
shSCN4B cells (Fig. 5e). The sensitivity of INa to TTX was
unchanged in shSCN4B cells and could almost be fully inhibited by 30 mM TTX (inhibited by 85.62.9%, n 712; Fig. 5f).
Because the persistent INa was similar in shCTL and shSCN4B cells, there was no difference in the efux of H in the two cell lines, measured as previously published25, by the addition of 130 mM NaCl in NH4Cl-pulse-wash-acidied cells in a sodium-
6 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
a
Voltage (mV)
b c
80 60 40 20 0 20 40 60
1.0
Activation/availability
0
shCTL
0
0
0.8
INa persistent
0.6
2 pA/pF
peak
0.4
5 ms
0.2
0.0
120
100
80
60
40
20
0 20
Voltage (mV)
d e f g h
shCTL
shSCN4B
0.25
NS
0.0
**
1.0
7.1
250
0.20
shCTL
I Napersistent -30 mV
(pA/pF)
Ipersistent / Ipeak
H+ efflux ( M s1 )
0.2
0.8
7.0
% I Nainhibition
Intracellular pH
200
0.15
0.4
0.6
6.9
150
0.10
0.4
0.6
6.8
100
0.05
0.2
6.7
0.8
50
0.0
1.0
NS 0.00
6.6
0 12
2 4 6 8 10
0 shSCN4B
shCTL
shSCN4B
1E10
1E09
1E08
1E07
1E06
1E05
1E04
shCTL
Time (min)
SCN4B
[TTX] (M)
SCN4B
i j
F-actin DQ-Gelatin Coloc
Matrix focalized degradation
index (relative to shCTL)
1.2
shCTL sh SCN4B
1.0
0.8
0.6
0.4
0.2
0.0
shCTL
NS
shSCN4B
20 m
Figure 5 | Loss of SCN4B/b4 expression maintains NaV1.5-mediated persistent current and dependent extracellular matrix degradation. (a) Sodium current (INa)voltage relationships in shCTL (black squares, n 18) and in shSCN4B (red circles, n 22) cells. There was a signicant difference at
Po0.001 between the two conditions in the voltage range between 40 and 40 mV. (b) Activation (lled circles) and availability (lled squares )
voltage relationships in shCTL (black symbols) and shSCN4B (red symbols) cells. (c) INa peak and INa persistent currents obtained from shCTL (black trace) and shSCN4B (red trace) cells for a membrane depolarization from 100 to 30 mV. (d) Mean valuess.e.m. of INa persistent currents obtained for a
membrane depolarization from 100 to 30 mV from 18 shCTL and 21 shSCN4B cells. NS, not statistically different. (e) Mean valuess.e.m. of INa
persistent/INa peak currents ratios obtained from 18 shCTL and 21 shSCN4B cells. **, statistically different from shCTL at Po0.01. (f) Doseresponse effect of TTX on the inhibition of INa peak elicited by a membrane depolarization from 100 to 5 mV in shCTL (black squares, n 812) and in shSCN4B (red
circles, n 712) cells. Data were tted with the Hill equation and IC50 values were 2.020.10 and 2.240.11 mM for shCTL and shSCN4B cells,
respectively. (g) Intracellular pH measurements using the BCECF-AM probe, in NH4Cl-acidied shCTL (black trace) and shSCN4B (red trace) cells in the absence of NaCl. NaCl (130 mM) was added at the time indicated (arrow). (h) H efux measurements after the addition of NaCl in conditions similar to g (n 20). Results are expressed as mean valuess.e.m. NS, no statistical difference. (i) MDA-MB-231 shCTL or shSCN4B cells were cultured on a Matrigel
matrix containing DQ-Gelatin. A Matrix-Focalized-degradation index was calculated as being F-actin foci (red labelling, phalloidin-Alexa594) co-localized with focused proteolytic activities (green) (n 442 cells for shCTL and 448 cells and shSCN4B). Results are expressed as mean valuess.e.m. NS, no
statistical difference. (j) Representative pictures showing matrix degradation areas (green spots) and F-actin foci (red spots). Merging points (coloc), which appear as white pixels, were counted. Numbers of white pixels per cell were normalized to the mean value obtained in shCTL cells. Statistics were performed using Students t-test.
free solution (Fig. 5g,h). As a consequence, shSCN4B cells demonstrated identical ECM degradative activities as compared with shCTL cells (Fig. 5i,j), and similar levels of co-localization between the phosphorylated form (Y421) of the actin nucleation-promoting factor cortactin, used as a marker of invadopodial structures41, and DQ-gelatin degradation (Supplementary Fig. 5c). These results suggested that the invadopodial activity was similar in shCTL and shSCN4B cells.
RhoA-dependent amoeboid cell migration. While cells lacking SCN4B expression have the ability to degrade the ECM, the pharmacological inhibition of proteases by GM6001 (MMP inhibitor), leupeptin (cysteine, serine and threonine peptidases inhibitor) or E64 (cysteine cathepsin inhibitor) did not completely prevent the increased invasiveness observed in shSCN4B as compared with shCTL cells (Fig. 6a). The most potent effect was obtained with GM6001, which reduced shSCN4B cell
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 7
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
a d
#
b c
***
***
500
0 shCTL
***
3.0
2.0
Cancer cell invasiveness
(relative to shCTL condition)
100
50
50
100
150
shCTL shSCN4B
m
2.5
400
2.0
***
***
***
1.5
300
1.5
200 100
m
0
0 100 200
200 100
100
50
50
100
150
0
0 100 200
Migration speed (m min1 )
m
1.0
Track length (m)
1.0
200
0.5
0.5
100
0.0
shCTL
GM6001
E64 Leupeptin
0.0
shCTL
shSCN4B
shSCN4B
shSCN4B
e f
CTL GM6001
CTL GM6001
100
50
0
50
100
100
50
0
50
100
1,500
##
3D invasion -track length (m)
***
shCTL
100 50
m
0
50 100 150
100 50
m
0
50 100 150
***
m
m
1,000
500
100
50
0
50
100
100
50
0
50
100
0
shSCN4B
GM6001 + + shSCN4B
100 50
m
0
50 100 150
100 50
m
0
50 100 150
shCTL
Figure 6 | The loss of SCN4B/b4 expression promotes human cancer cell migration and invasiveness in two and three dimensions. (a) Cancer cell invasiveness was assessed using Matrigel-invasion chambers from shCTL or shSCN4B MDA-MB-231 cells, in the absence ( ) or presence of the protease
inhibitors GM6001 (10 mM), leupeptin (200 mM) or E64 (100 mM). Results from three to seven independent experiments are presented and were expressed relative to shCTL cells in the absence of inhibitors. Results are expressed as mean valuess.e.m. *** denotes a statistical difference from the shCTL at Po0.001, and # indicates a statistical difference from shSCN4B at Po0.05 (ANOVA). (b) Cancer cell migration of shCTL and shSCN4B cells measured by time-lapse microscopy to track the movement of cells over 180 min, 1 frame per min (n 20 representative cells in each condition). Distances
are indicated in mm. (c) The speed of migration (in mm min 1) was analysed in shCTL and shSCN4B cells from time-lapse experiments and results shown were obtained from 106 and 96 cells, respectively. *** denotes a statistical difference from the shCTL at Po0.001 (MW). (d) The track length of cell migration (in mm) was analysed over 180 min in shCTL and shSCN4B cells from time-lapse experiments and results shown were obtained from 106 and 96 cells, respectively. *** denotes a statistical difference from the shCTL at Po0.001 (MW). (e) Three-dimension (3D) invasiveness of shCTL and shSCN4B cells, embedded inside Matrigel, was measured by time-lapse microscopy to track the movement of cells over 48 h (1 frame per 30 min) in the absence (CTL) or presence of the MMP inhibitor GM6001 (10 mM) (n 13 representative cells in each condition). Distances are indicated in mm. (f) The
track length of 3D cell invasiveness (in mm) was analysed over 48 h in shCTL and shSCN4B cells from time-lapse experiments and results shown were obtained from 30 cells in each condition. ** and *** denote statistical difference from the shCTL, CTL condition at Po0.01 and Po0.001, respectively.
## denotes a statistical difference from the shSCN4B, CTL condition at P 0.002. y denotes a statistical difference from the shCTL, GM6001 condition
at P 0.038 (Dunns test). (c,d and f) Box plots indicate the rst quartile, the median and the third quartile; whiskers indicate minimum and maximum
values; squares show the means. Error bars encompass 95% of data samples.
invasiveness by about 32%. This suggested that the enhancement of invasiveness was not solely due to an increase in ECM proteolysis, thus prompting us to analyse the migratory abilities of cell lines using time-lapse cell tracking experiments (Fig. 6b). As expected, the loss of SCN4B expression signicantly increased the migration speed (medians were 0.889 mm min 1 for shCTL (n 106) and 1.265 mm min 1 for shSCN4B cells (n 96),
Po0.001, MannWhitney rank sum test; Fig. 6c), as well as the track length after 3 h measurements (medians were 177.76 mm for shCTL (n 106) and 246.73 mm for shSCN4B cells (n 96),
Po0.001, MannWhitney rank sum test; Fig. 6d), but with no change in net displacement (Supplementary Fig. 6f). This increase in migration velocity was evocative of a transition towards the amoeboid invasiveness, which is better visualized in three-dimensional (3D) matrices. To study this property more
adequately shCTL and shSCN4B cells were seeded into a 3D matrix composed of Matrigel and invasive abilities were analysed, in the absence or presence of GM6001, using time-lapse single-cell tracking over 48 h (Fig. 6e). The loss of SCN4B expression signicantly increased the 3D track length travelled by cells over 48 h (medians were 399.39 mm for shCTL and 789.11 mm for shSCN4B, Po0.001, MannWhitney rank sum test; Fig. 6f).
This increase in 3D invasion could not be attributed to the increase in ECM degradative activity, since shSCN4B invasion was signicantly higher than in shCTL cells in the presence of GM6001 (medians were 246.76 mm for shCTL GM6001
(n 30) and 379.87 mm for shSCN4B GM6001 (n 30),
P 0.038, MannWhitney rank sum test; Fig. 6f). The amoeboid
phenotype is generally characterized by a rounded morphology, the presence of blebs at the cell surface and a relative
8 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
independence of the interaction with the substratum revealed by a decreased number of lopodial structures. Consistent with this, shSCN4B cells demonstrated striking changes in morphology with a higher circularity index (0.480.02 (n 88) versus
0.340.02 (n 88) in shSCN4B and shCTL, respectively,
Po0.001, Students t-test; Fig. 7a). Using scanning electron microscopy (SEM), we also noticed a decreased number of lopodia-like structures per cell (medians were 19.0 (n 60)
versus 44.5 (n 66) in shSCN4B and shCTL, respectively,
Po0.001, MannWhitney rank sum test; Fig. 7b,c), and an increase in the number of blebs per cell (medians were 100.5 (n 82) versus 27.5 (n 82) in shSCN4B and shCTL,
respectively, Po0.001 MannWhitney rank sum test; Fig. 7bd). These blebs were relatively small with diameters between 0.5 and0.7 mm (Fig. 7b). To conrm that the lopodia-like structures observed by SEM were real lopodia, and not retraction bres,
a
b c d
shCTL shSCN4B
0.6
shSCN4B
100
***
350
***
Number of filopodia-like structures
per cell (SEM)
***
Number of blebs per cell (SEM)
0.5
300
80
Circularity index
Amoeboid
Mesenchymal
250
0.4
60
200
0.3
40
150
0.2
100
shCTL
50 m
0.1
20
50
10 m
0
0
shCTL shSCN4B
0.0
shCTL shSCN4B
shCTL shSCN4B
e f
g
h
shCTL shSCN4B
20 m
5 m
20 m
***
15 ***
Number of filopodia per cell
(confocal)
30
Length of filopodia (in m)
10
20
5
10
i
10 m
0
0 shCTL shSCN4B
shCTL shSCN4B
5 m
i
shSCN4B
j
k
l
shCTL shSCN4B
Merged
DAPI DAPI
50 m
Merged
1.4
GTP-bound forms of RhoGTPases
(relative to shCTL)
MW (kDa)
shCTL
**
RhoA-GTP 25
20 25 20
3.0
Cancer cell invasiveness
(relative to shCTL condition)
1.2
2.5
***
###
RhoA total
Rac1-GTP
Rac1 total
25 20 25 20
1.0
2.0
50 m
50 m
*
1.5
SCN4B-RhoA
SCN4B-RhoA
0.8
1.0
Cdc42-GTP 25
20 25 20
Cdc42 total Blebbistatin + +
0.0
0.6
0.5
shCTL RhoA Rac1 Cdc42
50 m
shSCN4B
shCTL shSCN4B
Figure 7 | The loss of SCN4B/b4 expression promotes RhoA-dependent amoeboid cell transition and migration. (a) F-actin was stained with phalloidin-AlexaFluor594 in shCTL and shSCN4B cells and a cell circularity index was calculated (n 88 cells per condition). Results are expressed as mean
valuess.e.m. ***Po0.001 from shCTL (Students t-test). (b) Representative SEM micrographs of shCTL and shSCN4B cells. Scale bars, 10 mm.(c) Number of lopodia-like structures per cell, counted from SEM pictures in shCTL and shSCN4B cells (n 60 and 66 cells, respectively). ***Po0.001
from shCTL (MW). (d) Number of blebs per cell, counted from SEM micrographs in shCTL and shSCN4B cells (n 82 cells per condition). ***Po0.001
from shCTL (MW). (e) Representative confocal micrographs of shCTL and shSCN4B cells for which F-actin was stained with phalloidin-AlexaFluor488 (green) and nuclei with DAPI (blue), scale bar 20 mm. For enlargements images, scale bars are 5 mm. (f) Number of lopodia per cell, counted from confocal micrographs in shCTL and shSCN4B cells (n 46 and 66 cells, respectively). ***Po0.001 from shCTL (MW). (g) Length of lopodia, measured from
confocal micrographs, in shCTL and shSCN4B cells (n 1,070 and 593 lopodia, respectively). ***, statistically different from shCTL at Po0.001 (MW).
(h) SEM observations of shSCN4B cell invasion 24 h after cells were seeded on a layer of Matrigel (4 mg ml 1). The coloured structure is the tip of the cell still observable above the Matrigel layer, while penetrating inside the matrix. Scale bar, 10 mm. (i) Western blots showing total and active GTP-bound forms of RhoA, Rac1 and Cdc42, pulled down by GST-RBD in shCTL and shSCN4B cells. (j) Quantication of GTP-bound RhoGTPases (active), normalized to total protein level, and expressed relatively to that of shCTL (n 5). **, statistically different from shCTL at Po0.01 and * at Po0.05 (MW). (k) shCTL or
shSCN4B cancer cell invasiveness, in the absence ( ) or presence of blebbistatin (50 mM) (n 3). Results are expressed as mean valuess.e.m.
***Po0.001 from shCTL, and ###Po0.001 from shSCN4B (ANOVA). (l) Left panel, in situ proximity ligation assays showing a strong proximity between SCN4B/b4proteins and RhoA in shCTL cells (red dots, left panel) and the absence of any proximity signal in shSCN4B cells (right panel). Scale bars, 50 mm. (c,d,f,g,j) Box plots indicate the rst quartile, the median and the third quartile; whiskers indicate minimum and maximum values; squares show the means.
Error bars encompass 95% of data samples.
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 9
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
we also stained F-actin and performed confocal imaging (Fig. 7e). In agreement with results previously obtained in SEM, shSCN4B cells displayed less lopodia than shCTL cells (median were 8 (n 66 cells) versus 24.5 (n 46 cells) lopodia/cells for
shSCN4B and shCTL, respectively, Po0.001, MannWhitney rank sum test; Fig. 7e,f). Furthermore, lopodia in shSCN4B cells were smaller than in shCTL cells (median length were 3.43 versus5.61 mm in shSCN4B and shCTL, respectively, Po0.001, MannWhitney rank sum test; Fig. 7eg). The morphological changes observed in shSCN4B cells might result from a transition towards an amoeboid phenotype that could confer cancer cells the ability to squeeze and migrate through small gaps of the ECM. Using SEM, we conrmed that shSCN4B cells demonstrated the ability to migrate through Matrigel, probably after they opened a narrow interstice by focalized degradation (Fig. 7h, Supplementary Fig. 7). The interconversions between mesenchymal and amoeboid modes of invasion are known to be orchestrated by RhoGTPases and the amoeboid movement mainly relies on the RhoA-ROCK-pMLCII signalling pathway. We therefore assessed the proportion of active (GTP-bound) RhoGTPases in shCTL and shSCN4B cells by pull-down assays (Fig. 7i) and found a signicant increase in RhoA concomitant with decreases in Rac1 and Cdc-42 activities (Fig. 7j). Furthermore, the inhibition of myosin II with blebbistatin42 signicantly reduced shSCN4B cancer cell invasiveness by approximately 27%, while it had no effect on shCTL cell invasiveness (Fig. 7k). Interestingly, proximity ligation assays indicated a close association of the SCN4B/b4 protein and RhoA in shCTL cells while no signal was observed in shSCN4B cells (Fig. 7l). Because the reduced expression of SCN4B increases cancer cell aggressiveness, we investigated whether its stable experimental overexpression (oeSCN4B) could have opposite effects. The overexpression of SCN4B gene, conrmed by qPCR and western blotting experiments (Supplementary Fig. 8a,b), signicantly reduced cancer cell invasiveness by 51.66.8% (n 6) in oeSCN4B as compared with control cells and by about
82% as compared with shSCN4B cells (Fig. 8a). To further investigate the regulation of NaV activity and NaV-dependent invasiveness, we performed invasion experiments in the presence or absence of 30 mM TTX. While TTX reduced the invasion of control (oeCTL) cells to an extent similar to that found in wild-type or shCTL cells (i.e., a reduction by 30.74.0%, n 6),
it had no further effect on reducing the invasive properties of oeSCN4B cells (Fig. 8b). Overexpressing SCN4B did not affect cancer cell growth and viability (Supplementary Fig. 8c). These results suggested that overexpression of SCN4B not only reduced the invasiveness via the SCN4B/b4 protein-dependent signalling pathway but also inhibited the NaV-dependent mesenchymal invasion. To test this hypothesis, we analysed INa in oeSCN4B
cells. The maximal peak INa was higher in oeSCN4B cells as compared with oeCTL or shCTL cells, while the sensitivity to TTX remained unchanged (Fig. 8c and Supplementary Fig. 8d). In oeSCN4B cells, the INa activationvoltage relationship was not different from that of oeCTL cells (V1/2activation were 42.80.4 mV (n 43) and 41.90.8 mV (n 15),
respectively; Fig. 8d) and the availabilityvoltage relationship was slightly, but not signicantly, shifted towards hyperpolarized values in oeSCN4B as compared with those obtained with oeCTL cells (V1/2availability were 88.61.0 and 86.70.5 mV,
respectively, P 0.459, MannWhitney rank sum test; Fig. 8d).
This result was not statistically signicant when compared with the V1/2availability in shCTL cells ( 86.31.6 mV,
P 0.146, MannWhitney rank sum test), but was signicant
when compared with the V1/2availability in shSCN4B cells ( 80.61.6 mV, Po0.001, MannWhitney rank sum test).
We however measured a decrease in the persistent INa current
(Fig. 8e) and in INa persistent/peak ratio in oeSCN4B cells as compared with oeCTL (Fig. 8f) and a signicant reduction of the focalized Matrigel degradation (Fig. 8g), suggesting that overexpression of SCN4B/b4 protein slightly reduced the persistent window current and its associated ECM proteolytic (mesenchymal) activity in cancer cells. This observation was also accompanied with reductions in the cell circularity index (from0.490.02 (n 73) to 0.380.02 (n 73) in oeCTL and
oeSCN4B, respectively, Po0.001, Students t-test; Fig. 8h and Supplementary Fig. 9a), in the migration speed (medians are0.983 mm min 1 for oeCTL (n 47) and 0.520 mm min 1 for
oeSCN4B cells (n 47), Po0.001, MannWhitney rank sum test;
Fig. 7i) and in RhoA activity (Fig. 8j,k). Overall, these results indicate that SCN4B/b4 protein reduces mesenchymal invasion and prevents amoeboid migration by reducing NaV and RhoA activities, respectively.
SCNxB/b proteins, initially characterized as being auxiliary subunits of NaV, have been proposed to also act as cell adhesion molecules (CAMs) via their immunoglobulin-like extracellular domain14. To investigate the participation of SCN4B/b4 protein domains in the phenotypical changes observed, we constructed different variants of the protein intended to be overexpressed in shSCN4B cells. For this purpose, the nucleotide sequence was mutated so that the transcripts would not to be targeted by the shRNA. Eight nucleotides were substituted without altering the amino acid sequence. The full-length sequence allowed the expression of a wild-type b4 protein in shSCN4B cells. We also constructed two truncated variants: an N-terminus-truncated protein (from residue M1 to T161), called DN-ter, containing the transmembrane and C-terminus intracellular domains of the SCN4B/b4 protein but completely devoid of the Ig-like extracellular domain, and a SCN4B/b4 protein truncated in the C-terminus region, from residue K185, and identied as being DC-ter (Fig. 9a). The DC-ter construct contained the same eight substituted nucleotides with conservation of the amino acid sequence so that it could be expressed in shSCN4B cells. The protein expression level of these variants at the plasma membrane was similar (Supplementary Fig. 9b). The reintroduction of the full-length SCN4B/b4 protein signicantly reduced cancer cell invasiveness as compared with the empty vector (pSec), and as such, performed as an effective rescue. Interestingly, the DC-ter variant, which possessed the extracellular domain, was completely ineffective, whereas the DN-ter variant reduced cell invasiveness to the same extent as the full-length protein (Fig. 9b). The invasiveness of shSCN4B cells overexpressing the DN-ter variant or the full-length protein was still superior to the one of shCTL cells by about 50%. In agreement with these results, only the full-length and the DN-ter proteins reduced the speed of migration and RhoA activity (Fig. 9c,d) in shSCN4B cells, therefore demonstrating that the intracellular C-terminus of the SCN4B/b4 protein, and not the extracellular Ig-like domain, is needed to inhibit invasiveness in breast cancer cells.
Tumour progression. Two important steps in tumour progression are the entry of cancer cells into the vasculature and their dissemination into the general circulation before colonization of secondary organs. This progression requires cellular intravasation/extravasation abilities that can be assessed in vitro using transendothelial invasion (with an initial migration through the ECM, before crossing over the endothelium) and migration protocols, respectively. In both experiments, the downregulation of SCN4B importantly potentiated the capacity of cancer cells to migrate through a monolayer of endothelial cells, after having invaded (invasion), or not (migration), a layer of matrigel, as compared with shCTL or oeSCN4B cells (Fig. 10a,b).
10 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
a b c d e
3.5
***
Voltage (mV)
1.0
oeCTL oeSCN4B
3.0
Cancer cell invasiveness
(relative to CTL)
80 60 40 20 0 20 40 60
30
0.0
1.0
Activation / availability
Cancer cell invasiveness
(relative to CTL)
2.5
###
0.8
Ipersistent -30 mV(pA/pF)
**
NS
2.0
0.8
0.2
0.6
** **
1.5
0.6
0.4
0.4
1.0
0.4
**
0.6
0.5
0.2
*
0.2
0.0
0.0
0.8
CTL
shSCN4B
oeSCN4B
TTX (30 M) + +
0.0
120 100 80 60 40 20 0 20
oeCTL oeSCN4B
1.0
Voltage (mV)
f g h i j k
oeSCN4B
MW (kDa)
oeCTL
0.07
2.5
0.6
1.1
0.06
NS
RhoA-GTP
RhoAtotal
25 20
25 20
25 20 25 20
Matrix focalized degradation index
(relative to oeCTL)
2.0
NS
2.0
0.5
Ipersist / Ipeak
0.05
1.0
Circularity index
0.04
1.5
0.4
***
1.5
0.9
1.0
Rac1-GTP
Rac1 total
0.03
0.3
Migration speed (m min)
GTP-bound forms of RhoGTPases
(relative to oeCTL)
***
1.0
0.02
0.8
0.5
0.2
0.01
0.5
Cdc42-GTP
Cdc42 total
0.7
0.0
0.1
0.00
25 20
25 20
oeCTL oeSCN4B
0.5
0.0 oeCTL oeSCN4B
0.0
0.6
oeCTL oeSCN4B
oeCTL oeSCN4B oeCTL RhoA Rac1 Cdc42
oeSCN4B
Figure 8 | SCN4B/b4 protein overexpression inhibits cancer cell invasiveness. (a) CTL, shSCN4B and oeSCN4B cancer cell invasiveness, in the absence ( ) or presence of TTX (30 mM), expressed relative to oeCTL cells in the absence of TTX (n 6). Results are expressed as mean valuess.e.m.
***, different from CTL at Po0.001, ** at Po0.01. ###, different from shSCN4B at Po0.001 (ANOVA). NS, no statistical difference. (b) Cancer cell invasiveness (n 6) from oeCTL and oeSCN4B cells, in the absence ( ) or presence of TTX (30 mM), expressed relative to oeCTL cells in the absence of
TTX. Results are expressed as mean valuess.e.m. **, different from oeCTL at Po0.01. NS, no statistical difference (ANOVA). (c) INavoltage relationships in oeCTL (black squares, n 15) and oeSCN4B (green triangles, n 43) cells. There was a signicant difference at Po0.05 between the two conditions in
the voltage range between 45 and 45 mV. (d) Activation (lled circles) and availability (lled squares)voltage relationships obtained in the same
oeCTL (black symbols) and oeSCN4B (green symbols) cells as in c. (e) Mean valuess.e.m. of INa persistent currents obtained for a membrane depolarization from 100 to 30 mV from 15 oeCTL and 43 oeSCN4B cells. *Po0.05 from oeCTL (Students t-test). (f) Mean valuess.e.m. of INa
persistent/INa peak current ratios in same conditions as in e. ***P 0.001 (Students t-test). (g) oeCTL or oeSCN4B cells were cultured on a
Matrigel-composed matrix containing DQ-Gelatin, and a Matrix-Focalized-degradation index was calculated (n 77 and 69 cells for oeCTL and oeSCN4B,
respectively). ***, statistically different from oeCTL at Po0.001 (MW). (h) Cell circularity index was calculated from oeCTL and oeSCN4B cells(n 73 cells per condition). Results are expressed as mean valuess.e.m. ***, statistically different from oeCTL at Po0.001 (Students t-test). (i) Speed of
migration (mm min 1) of oeCTL and oeSCN4B cells analysed from time-lapse experiments (n 47 per condition). ***, statistically different from oeCTL at
Po0.001 (MW). (j) Western blots showing total and active GTP-bound forms of RhoA, Rac1, Cdc42, pulled down by GST- in oeCTL and oeSCN4B cells. (k) Quantication of GTP-bound RhoGTPases in oeSCN4B cells, normalized to its total protein level, and expressed relatively to that of oeCTL cells (n 4).
*, statistically different from the oeCTL at Po0.05. NS, no statistical difference (MW). (g,i,k) Box plots indicate the rst quartile, the median and the third quartile; whiskers indicate minimum and maximum values; squares show the means. Error bars encompass 95% of data samples.
We then studied the involvement of the SCN4B gene and its expression product, the SCN4B/b4 protein, in tumour progression. For this we used oeSCN4B and shSCN4B cells as models of cancer cells, coming from the same lineage and solely differing by the presence of high levels of SCN4B/b4 protein (similar to non-cancerous mammary cells, oeSCN4B cells) or the complete absence of SCN4B/b4 protein (similar to high-grade cancers, shSCN4B cells). We developed two in vivo models in immuno-depressed mice. In the rst model, we assessed the importance of SCN4B expression in human breast cancer cells for the colonization of organs. ShSCN4B or oeSCN4B cells, both having identical in vitro growth and viability properties and similarly expressing the luciferase gene (Supplementary Fig. 8ce), were injected in the tail vein of NMRI nude mice. After 9 weeks, there was no statistical difference in animal body weights between the two experimental groups (Supplementary Fig. 8f). Mice were euthanized and the isolated organs (lungs, brain, liver, bones from spine/ribs and legs) were analysed ex vivo for bioluminescent imaging after luciferin injection (Fig. 10c). In the shSCN4B group, all mice showed lung metastases (7/7), while in the oeSCN4B group, only one mouse out of eight had lung colonization and there was no bioluminescent signal in other organs (Yates w2,
P 0.0041). Altogether, there was a strong reduction in lung
colonization by cancer cells overexpressing SCN4B/b4 compared with non-expressors (Fig. 10d). In the other model of orthotopic xenograft of mammary cancer, in which shSCN4B or oeSCN4B cells were injected into the mammary fat pad of NOD SCID mice, the primary tumour growth was analysed as a function of time for 23 weeks. There was no statistical difference in the evolution of animal body weights between the two experimental groups (8 mice/group; Supplementary Fig. 10a). The growth of primary mammary tumours, measured with a calliper (Supplementary Fig. 10b) or by bioluminescent imaging (Fig. 10e,f), was reduced in mice implanted with oeSCN4B cells compared with those implanted with shSCN4B. At the end of the study, primary mammary tumours from the two groups were analysed and the non-expression of SCN4B/b4 in the shSCN4B group or expression in the oeSCN4B group was conrmed by immunohistochemistry (Fig. 10g). Finally, 5/8 mice implanted with shSCN4B cells had more metastatic foci (3/8 in lungs, 1 in spine and 1 in posterior legs) compared with those implanted with oeSCN4B cells (only 1/8 mouse showed lung metastases) (Yates w2 P-value 0.039; Supplementary Fig. 10ce). The presence of
human breast cancer cells in mouse lungs was conrmed by
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 11
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
a b
NH2
COOH
3.0
NS
(relative to shCTL condition)
2.5
NS
Cancer cell invasiveness
2.0
##
###
1.5
1.0
K185
Full length
NH2
K185 COOH
C-ter
K185
N-ter
0.5
COOH
0.0
shCTL
pSec
C-ter
N-ter
Full
length
shSCN4B
c d
NS
4
1.4
*** ***
Migration speed (m min1 )
(relative to shSCN4B/pSec)
1.2
3
NS
1.0
2
RhoA-GTP /total RhoA
0.8
1
0.6
0
0.4
shCTL
pSec
C-ter
N-ter
Full length
pSec
C-ter
N-ter
Full length
shSCN4B
shSCN4B
Figure 9 | SCN4B/b4 protein inhibits cancer cell invasiveness through its intracellular C-terminus but not through its extracellular Ig-like domain. (a) Cartoon showing the transmembrane structure of the b4 protein, encoded by the SCN4B gene. The extracellular domain contains an Ig-like structure.
After introduction of synonymous nucleotide substitutions in the SCN4B sequence, we have generated a sequence that is not recognized by the small hairpin RNA targeting SCN4B expression. This sequence has been inserted into a pSec expression vector in order to overexpress the full-length b4 protein (called Full-length) in shSCN4B cells. Alternatively, we have also created truncated versions of the b4 protein: one containing a deletion of its intracellular
C-terminus, from residue K185, and called DC-ter, and one containing a deletion of its extracellular N-terminus up to residue T161, and called DN-ter. The nucleotide sequences were inserted into the pSec mammalian expression vector. (b) Cancer cell invasiveness was assessed using Matrigel-invasion chambers from shCTL and shSCN4B, transfected with an empty expression vector (pSec), or transfected with DN-ter, DC-ter or Full-length encoding sequences. Results are expressed as mean valuess.e.m. ###, statistically different from shSCN4B/pSec at Po0.001 and ## at Po0.01. NS, not statistically different (ANOVA). (c) The speed of migration (in mm min 1) was analysed from time-lapse experiments with shCTL and shSCN4B cells, transfected with an empty expression vector (pSec), or transfected with DN-ter, DC-ter or Full-length encoding sequences, and results shown were obtained from 30 cells in each condition. ***, statistically different from shCTL at Po0.001. ###, statistically different from shSCN4B/pSec at Po0.001. NS, not statistically different (Dunns test). (d) Quantication of GTP-bound RhoA in shSCN4B cells, transfected with empty vector (pSec), with DN-ter, DC-ter or Full-length encoding sequences. The activity of GTP-bound (active) RhoAGTPase was normalized to its total protein level, and was expressed relatively to that of shSCN4B/pSec cells (n 3). *, statistically different from shSCN4B/pSec at Po0.05 (MW). (c,d) Box plots indicate the rst quartile,
the median and the third quartile; whiskers indicate minimum and maximum values; squares show the means. Error bars encompass 95% of data samples.
human cytokeratin 7 immunoreactivity (Fig. 10h). All together, these results indicate that the overexpression of SCN4B in cancer cells reduces primary tumour growth and metastatic colonization.
DiscussionSCNxB/b proteins were initially isolated from rat brain along with pore-forming NaV sodium channels43. They all exhibit an extracellular N-terminus containing an immunoglobulin domain. With the exception of the soluble b1B protein44, all SCNxB/b subunits have a single a-helical transmembrane domain and a short intracellular domain45. SCNxB/b proteins were demonstrated to interact, through covalent or non-covalent
associations, with pore-forming Nav channels4649, to regulate their trafcking to the plasma membrane, as well as their biophysical50 and pharmacological5153 properties. Because of these functions, SCNxB/b proteins were initially characterized as being auxiliary subunits of pore-forming Nav in excitable cells. Besides these canonical roles, it has later been proposed that they might also have other specic cellular functions54. Indeed, the presence of an Ig motif in their extracellular domain, similar to that of CAMs such as integrins, cadherins and selectins, argued for a possible function in cell adhesion properties55,56. SCN1B/b1 and SCN2B/b2 subunits were demonstrated to form both transhomophilic and trans-heterophilic cellcell and cellmatrix adhesions in cells expressing Nav, such as neurons in which
12 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
a b c d
Migration transwell
Invasion transwell
Cancer cells
Endothelium
Matrigel
P = 0.014
100
shSCN4B
oeSCN4B
Filter
Filter
80
4
P = 0.029
7
Transendothelial migration
(relative to shCTL)
Ex vivolung BLI (AU)
P = 0.016
P = 0.010
P = 0.029
60
Transendothelial invasion
(relative to shCTL)
6
3
5
40
4
20
2
3
2
0
1
1
shSCN4B oeSCN4B
shCTL shSCN4B oeSCN4B
shCTL shSCN4B oeSCN4B
e f g h
1 2 3 4 5
counts
6 x102
*
shSCN4B
shSCN4B
oeSCN4B
1.6x106
In vivoprimary tumour BLI (c.p.m.)
1.4x106
shSCN4B
oeSCN4B
1.2x106
1.0x106
8.0x105
1 2 3 4 5 6 x102
Primary mammary tumours Lungs
6.0x105
counts
4.0x105
oeSCN4B
2.0x105
oeSCN4B
0.0 10 12 14 16 18 20 22 24
Weeks after implantation
shSCN4B
Figure 10 | SCN4B expression inversely correlates with primary tumour growth and metastatic development. (a) Top cartoon, transendothelial migration experiment. Bottom box plot, quantication of the number of shCTL, shSCN4B or oeSCN4B cancer cells migrating through the endothelium (HUVEC monolayer) and the 8-mm pore-sized lter of the migration transwell, expressed as a relative number to shCTL (4 independent experiments).
(b) Top cartoon, transendothelial invasion experiment. Bottom box plot, quantication of the number of shCTL, shSCN4B or oeSCN4B cancer cells migrating through the extracellular matrix (matrigel) coating the 8-mm pore-sized lter of the invasion transwell, then endothelium (HUVEC monolayer), expressed as a relative number to shCTL (three independent experiments). (c) Bioluminescent imaging (BLI) performed in NMRI nude mice tail vein-injected with
MDA-MB-231-Luc cells that do not express (shSCN4B), or which overexpress, the SCN4B protein (oeSCN4B). Representative ex vivo lung BLI, after organ isolation, at completion of the study (ninth week after cell injection). (d) BLI quantication of excised lungs from mice injected with shSCN4B cells (n 7)
and mice injected with oeSCN4B cells (n 8) (MW). (e) Means.e.m. in vivo BLI value of tumours (expressed in c.p.m.) as a function of time recorded in
the whole body of mice. * denotes a statistical difference from the shSCN4B group at Po0.05 (Students t-test). (f) Representative bioluminescent images of mammary tumours in shSCN4B and oeSCN4B experimental groups (23rd week after cell implantation). (g) Immunohistochemical analyses of primary mammary tumours obtained from same mice as in Fig. 8e,f implanted with shSCN4B cells (top image) or with oeSCN4B cells (bottom image). Slides were counterstained with haematoxylin (blue labelling), and incubated with anti-mouse SCN4B/b4 antibodies and immunohistochemistry was performed using the streptavidin-biotin-peroxidase method with diaminobenzidine as the chromogen (brown labelling). Scale bars, 100 mm. (h) Immunohistochemical analyses of lungs obtained from the same mice as in Fig. 6e,f, implanted with human shSCN4B cells (top image) and oeSCN4B cancer cells (bottom image).
Slides were counterstained with haematoxylin (blue labelling), and human breast cancer cells were identied using anti-human cytokeratin 7 immunohistochemical (brown) labelling. Scale bars, 100 mm. (a,b,d) Box plots indicate the rst quartile, the median and the third quartile; whiskers indicate minimum and maximum values; squares show the means. Error bars encompass 95% of data samples.
they were proven to be critical for neurites outgrowth, axonal fasciculation and interactions with glial cells14.
The expression of SCNxB/b proteins and their physiological role in non-excitable cells have not been characterized. Their participation in oncogenic processes was not studied as much as that of pore-forming Nav proteins17. The most studied isoform in cancer is SCN1B/b1, and results published so far could appear contradictory. An initial in vitro study indicated that the expression of SCN1B/b1 was higher in poorly invasive than in highly invasive breast cancer cells. In weakly invasive MCF-7
cells, the downregulation of SCN1B/b1 reduced cell adhesion, and increased cell migration. Correlatively, its overexpression in MDA-MB-231 cells, increased cell process length and adhesion, reduced lateral motility and cell proliferation33. These results suggested that SCN1B/b1 expression could prevent cancer cell invasion. In contrast, a recent study demonstrated that SCN1B/b1 was overexpressed in breast cancer biopsies, compared with non-cancer breast samples. Furthermore, the overexpression of SCN1B/b1 in breast cancer cells potentiated their invasiveness in vitro, and increased primary tumour growth and metastatic
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 13
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
development in vivo27. The proinvasive role of SCN1B/b1 was proposed to depend on both Nav-dependent and Nav-independent mechanisms, relying on the extracellular Ig domain of the protein27. In this study, we found that SCN1B gene is downregulated in breast cancer compared with normal breast tissues. Nevertheless, we identied SCN1B as being the SCNxB gene the most highly expressed in cancer cells. Interestingly, the downregulation of SCN1B/b1 reduces in vitro invasiveness of MDA-MB-231, which is in line with results obtained by Nelson et al.27 showing this isoform displays pro-invasive roles in vitro. Concerning the SCN4B/b4 protein, there was no information regarding its potential involvement in the oncogenic process. Only one study identied that SCN4B expression was decreased in cervical cancer biopsies compared with non-cancer samples57.
Aggressive cancer cells present an important plasticity enabling them to use different invasion modes, conferring an ability to adapt to their microenvironment, matrix composition, meshwork, eventually promoting tumour growth and metastases development. While RhoGTPases are involved in invasive phenotypes, the upstream mechanism regulating their respective activation is not known. Here, we identied the SCN4B gene as an important modulator of RhoA activity and invasiveness in cancer cells. The SCN4B/b4 protein was known to be an auxiliary subunit of NaV in excitable cells. The present study shows for the rst time that this protein is expressed in non-cancer epithelial cells, which do not express NaV, suggesting a physiological non-auxiliary function. Furthermore, the expression of SCN4B/b4 is reduced in cancer tissues, and more specically when tumours gain invasive properties (transition from grade I to grade II). SCN4B/b4 is almost absent in high-grade tumours and metastases. At the cellular level, the loss of SCN4B/b4 in cancer cells further stimulates their invasiveness by favouring amoeboid migration, supported by the overactivation of the RhoA pathway, yet keeping the ECM-degradative activity intact. Conversely, the overexpression of SCN4B/b4 reduces cancer cell invasiveness, tumour growth and metastatic progression, supporting our proposal that the SCN4B gene is a metastasis-suppressor gene.
This study also demonstrates that the SCN4B/b4 protein acts both as NaV pore-subunit regulator and as RhoGTPases regulator in cancer cells. Indeed, the suppression of SCN4B gene expression in cancer cells reduced the peak sodium current due to NaV1.5 activity. This could be attributed to a reduction of SCN5A expression, and to a consequent reduction of channel density at the plasma membrane. However, we found that channels expressed at the plasma membrane of cancer cells show a higher activity through an increased persistent window current. The loss of interaction between NaV1.5 and SCN4B/b4 protein might therefore be responsible for a gain-of-function of NaV1.5. This is similar to what was observed in the case of the cardiac long QT syndrome LQT10, in which a missense mutation in the SCN4B gene, resulting in the L1759F amino acid substitution in the b4 protein, induces a gain-of-function of NaV1.5 with an increased persistent sodium current29. Because of this regulation of NaV1.5, the loss of SCN4B expression in cancer cells left NaV-dependent mesenchymal invasiveness unaffected, through the maintenance of a persistent sodium current that regulates ECM proteolysis, but also increased NaV-independent amoeboid-related cell migration, through the dynamic regulation of RhoGTPases. This latter property is under the control of the intracellular C-terminus and is independent of the extracellular CAM domain. These results contrast with those obtained with the pro-invasive SCN1B/b1 for which the extracellular Ig domain is crucial for its CAM function in breast cancer cells27. Our results further indicate that the intracellular C-terminus of SCN4B/b4 might play a critical role in maintaining epithelial function and integrity.
In conclusion, this study shows that the loss of SCN4B gene expression in cancer cells promotes the acquisition of an amoeboidmesenchymal hybrid phenotype, while its overexpression reduces both mesenchymal and amoeboid invasive capacities. The expression level of SCN4B could therefore represent an important prognosis marker in cancers from epithelial origin.
Methods
Prognostic analyses of gene expression in breast cancers. Analyses were performed using the software Breast Cancer Gene-Expression Miner v3.0 (bc-GenExMiner v3.0; http://bcgenex.centregauducheau.fr
Web End =http://bcgenex.centregauducheau.fr ) developed by the Integrated Center of Oncology Ren Gauducheau (Nantes-Saint Herblain, France), based on DNA microarrays results collected from published cohorts58. Briey, several statistical tests were conducted on each cohort and on all cohorts pooled together with data from all studies previously converted to a common scale with a suitable normalization. The prognostic impact of each gene was evaluated by means of the univariate Cox proportional hazards model. Results were displayed by cohorts and pools and are illustrated in a forest plot. KaplanMeier curves were then obtained on the pool with the gene values dichotomized according to gene expression median (calculated from the pool). Cox results corresponding to dichotomized values were displayed on the graph.
In silico RNA expression analyses. Expression of SCNxB genes in cancer tissues was studied using the web-based The Cancer Genome Atlas (http://cancergenome.nih.gov
Web End =http:// http://cancergenome.nih.gov
Web End =cancergenome.nih.gov ) from the US National Cancer Institute and the National Human Genome Research Institute that integrates RNE sequences databases. Data are expressed as RPKM (Reads Per Kilobase per Million).
Immunohistochemistry. The degree of SCN4B/b4 protein expression in normal and dysplastic mammary tissues, as well as in mammary ductal and lobular carcinomas, was analysed by standard immunohistochemistry procedures. Tissue microarrays (TMA) from formalin-xed, parafn-embedded mammary tissues were purchased from US Biomax Inc. (ref. BR1003, BC081120, BR10010a; Rockville, USA), comprising normal, hyperplastic and dysplastic mammary samples, lobular and ductal mammary carcinomas (separated in well (grade I), moderately (grade II) and poorly (grade III) differentiated carcinomas) and LNM samples. Similar analyses were also performed in a lung TMA (LC951; US Biomax Inc) containing normal lung, cancer lung (grades IA to IIIB) tissues and metastases (in lymph nodes, bones and intestine). TMA were analysed in blind conditions by C.M.-C. (anatomopathologist) and P.P. (immunologist, Clinical University Hospital Virgen de la Arrixaca, Murcia, Spain). Normal breast and cancer biopsies from the University-Hospital of Tours were coming from the tumour collection declared to the French Ministry of Research (No. DC2008-308) and were prepared by R.G. and analysed by G.F. (clinical anatomothologist at the University-Hospital of Tours, France).
Briey, after deparafnization and rehydration, sections were treated with a high-pH (Tris buffer/EDTA, pH 9.0) target retrieval procedure (Dako PT-link; Dako, USA). Endogenous peroxidase was then blocked by a commercial solution (Dako REAL), and incubated overnight with a 1/100 dilution of the primary polyclonal rabbit antibody anti-SCN4B/b4 protein (HPA017293; Sigma-Aldrich,
France) at 4 C. The antibody used recognizes the following extracellular peptide sequence of the b4 protein: LLPCTFSSCFGFEDLHFRWTYNSSDAFKILIEGTVK
NEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPK ENNLQHHATIFLQVV. Sections were then incubated with a commercial anti-rabbit-labelled polymer (Dako EnVision FLEX; Dako) for 30 min at RT. Immunoreaction was nally revealed with 3-30 diaminobenzidine solution (Dako)
for 5 min. Positive reaction was identied by a cytoplasmic dark-brown precipitate. To determine the degree of protein expression in tissues, a qualitative scale was used, for negative ( ), weak ( ) and strong ( ) cytoplasmic expression.
A unique score was given per core. The number of samples is representative of the number of cores, which is equivalent to the number of patients.
Lung and primary tumours from in vivo mouse experiments were xed in formalin, included in parafn, and cut in 5 mm tissue sections. Slides were deparafnized, rehydrated and heated in citrate buffer pH 6 for antigenic retrieval. The primary antibodies included monoclonal anti-human cytokeratin 7 (clone OV-TL 12/30; Dakocytomation, Glostrup, Denmark, dilution 1/100, 1 h), used on lung sections, and polyclonal anti-mouse SCN4B/b4 (dilution 1/100, 1 h), used on primary tumour sections. Immunohistochemistry was performed using the streptavidin-biotin-peroxidase method with diaminobenzidine as the chromogen (Kit LSAB, Dakocytomation). Slides were nally counterstained with haematoxylin. Negative controls were obtained after omission of the primary antibody or incubation with an irrelevant antibody.
Reagents and antibodies. TTX was purchased from Latoxan (France), and A803467 from R&D systems (France). Fluorescent probes and conjugated
14 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
antibodies were purchased from Fisher Scientic (France). Drugs and chemicals were purchased from Sigma-Aldrich.
Cell culture and cell lines. All cell lines were from the American Type Culture Collection (LGC Promochem, France) and were grown at 37 C in a humidied 5% CO2 incubator. The immortalized normal mammary epithelial cells MCF-10A were cultured in Dulbeccos modied Eagles medium (DMEM)/Hams F-12, 1:1 mix containing 5% horse serum (Invitrogen, France), 10 mg ml 1 insulin, 20 ng ml 1 epidermal growth factor, 0.5 mg ml 1 hydrocortisone and 100 ng ml 1 cholera toxin. MCF-7, MDA-MB-468 and MDA-MB-435s breast cancer cells were cultured in DMEM supplemented with 5% fetal calf serum (FCS). PC3 prostate, H460 and A549 non-small-cell lung cancer cells were cultured in DMEM supplemented with 10% FCS. MDA-MB-231-Luc human breast cancer cells, stably expressing the luciferase gene22, were cultured in DMEM supplemented with 5% FCS. We constructed a lentiviral vector encoding a short hairpin RNA (shRNA) specically targeting human SCN5A transcripts35. The sequence encoding shSCN5A, inhibiting the expression of NaV1.5 protein, was obtained by DNA polymerase ll-in of two partially complementary primers: 50-GGATCCCCAAGGCACAAGTGCGTGCG CAATTCAAGAGA-30 and 50-AAGCTTAAAAAAAGGCACAAGTGCGTGCG CAATCTCTTGAA-30.
Similarly, we constructed a lentiviral vector encoding a short hairpin RNA (shRNA) specically targeting human SCN4B transcripts, inhibiting the expression of b4 protein. The sequence encoding the shSCN4B was obtained by DNA polymerase ll-in of two partially complementary primers; this method also allowed the introduction of two restriction enzyme sites to facilitate manipulations. Forward primer: shb4-BamHI 50-GGATCCCCCAGCAGTGACGCATTCAAGA
TTCTTCAAGAGA-30and reverse primer: shb4-HindIII 50-AAGCTTAAAAACA GCAGTGACGCATTCAAGATTCTCTCTTGAA-30. We also constructed a lentiviral vector expressing a null-target shRNA (pLenti-shCTL), using the following primers: 50-GGATCCCCGCCGACCAATTCACGGCCGTTCAAGAG
ACG-30 and 50-AAGCTTAAAAAGCCGACCAATTCACGGCCGTCTCTTGA ACG-30. We constructed an expression plasmid containing the human SCN4B coding sequence to overexpress b4. This sequence was synthetized by Proteogenix (France) and inserted in pcDNA3.1, using the following sequences: 50-GGATCC GCCGCCACC-30 and 50-GCGGCCGCCTCGAG-30. We designed the mutated sequences coding for the Full-length SCN4B/b40 and truncated proteins, which were then synthetized by Proteogenix (France) and all sequences obtained were inserted into pSecTag2 hygro B vector (V910-20; Invitrogen) with the In-fusion HD cloning Plus kit (Clonetech). We constructed a plasmid containing the sequence coding for the N-terminally truncated (from residue 1 to residue T161, DN-ter) protein containing the transmembrane and C-terminal intracellular domain of the SCN4B/b4 protein. The sequence was obtained by PCR elongation using two specic primers: forward primer 50-GCGCCGTACGAAGCTGACCT GGAGTTCAGCGAC-30 and reverse primer 50- ACACTGGAGTGGATCTCAC ACTTTTGAAGGTGGTT-30. Similarly, an SCN4B/b4 protein truncated in the C-terminus, starting with residue K185 and identied as being DC-ter was designed. Importantly, for DC-ter and full-length the nucleotide sequence was mutated by substitution to avoid targeting by the shRNA targeting native SCN4B gene. The protein sequence remained unaffected. The sequence targeted by the shRNA was 50-CAGCAGTGACGCATTCAAATTC-30, while the substituted untargeted sequence was 50-TAGTAGCGATGCCTTTAAATAC-30. All variants exhibited an His-Tag and their expression and subcellular localization, after transfection of shSCN4B cells, were assessed by epiuorescence imaging using a primary rabbit anti-HisTag antibody (T2767; Invitrogen), and a secondary goat anti-rabbit Texas Red antibody (Thermosher, France).
Mycoplasma contamination tests were performed every week (Lonza, MycoAlert Mycoplasma Detection Kit).
Reverse transcription of RNA and real-time PCR. Total RNA extraction was performed using the RNAgents Total RNA Isolation System (Promega, France). RNA yield and purity were determined by spectrophotometry and only samples with an A260/A280 ratio above 1.6 were kept for further experiments. Total RNA were reverse-transcribed with the RT kits Ready-to-go You-prime First-Strand Beads (Amersham Biosciences, UK). Random hexamers pd(N)6 50-phosphate(0.2 mg; Amersham Biosciences) were added and the reaction mixture was incubated at 37 C for 60 min. Real-time PCR experiments were performed as previously described24. Primers sequences are given in Supplementary Table 1.
siRNA transfection and efcacy assessment. MDA-MB-231-Luc human breast cancer cells were transfected with 20 nM siRNA targeting the expression of SCN1B (siSCN1B, sc-97849), SCN2B (siSCN2B, sc-96252), SCN4B (siSCN4B, sc-62982) or scrambled siRNA (siCTL, siRNA-A sc-37007), which were produced by Santa Cruz Biotechnology and were purchased from Tebu-Bio (France). Transfection was performed with Lipofectamine RNAi max (Invitrogen) according to the manufacturers instructions, and used 24 h after transfection. The efciency of siRNA transfection was veried by qPCR using an iCycler system (BioRad, USA) and by western blotting.
Western blotting experiments. Cells were washed with phosphate-buffered saline (PBS) and lysed in the presence of a lysis buffer (50 mM Tris, pH 7, 100 mM NaCl,
5 mM MgCl2, 10% glycerol, 1 mM EDTA), containing 1% Triton-X-100 and protease inhibitors (Sigma-Aldrich). Cell lysates were cleared by centrifugation at 16,000 g for 10 min. Western blotting experiments were performed according to standard protocols. Total protein concentrations were determined using the Pierce BCA Protein Assay Kit Thermoscientic (Fisher Scientic, France). Protein sample buffer was added and the samples were boiled at 100 C for 3 min. Total protein samples were electrophoretically separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis in 10% gels, and then transferred to polyvinylidene uoride membranes (Millipore, USA). The SCNxB/b proteins were detected using anti-SCN1B/b1 (1/1,000, AV35028; Sigma-Aldrich), anti-SCN2B/b2 (1/200, HPA012585; Sigma-Aldrich) and anti-SCN4B/b4 (1/1,000, HPA01293, Sigma-Aldrich) rabbit polyclonal primary antibodies and horseradish peroxidaseconjugated goat anti-rabbit IgG secondary antibody at 1:2,000 (TebuBio, France). HSC70 protein was detected as a sample loading control using anti-HSC70 mouse primary antibody at 1:30,000 (TebuBio) and horseradish peroxidase -conjugated anti-mouse-IgG secondary antibodies at 1:2,000 (TebuBio). Proteins were revealed using electrochemiluminescence-plus kit (Pierce ECL Western Blotting Substrate; Fisher Scientic) and captured on Kodak Bio-Mark MS lms (Sigma-Aldrich). Full scans of western blots are shown in Supplementary Fig. 11.
RhoGTPases pull-down assays. Pull-down assays were performed according to the manufacturers protocol (Cat#BK030, RhoA/Rac1/Cdc42 Activation Assay Combo Biochem Kit; Cytoskeleton, Inc.). Briey, cells were washed on ice with ice-cold PBS, then lysed and scraped with ice-cold cell lysis buffer containing protease inhibitors (Sigma-Aldrich). Cell lysates were claried by centrifugation at 10,000 g, 4 C, 1 min, and the supernatant was snap-frozen in liquid nitrogen.
Ten microlitres of claried cell lysate were used to perform the protein assay (Cat#23225, BCA protein assay; Thermosher). Total proteins (300 mg) were incubated with 10 mg of PAK-PDB beads or 30 mg Rhotekin-RBD beads for 1 h on a rotator at 4 C. Samples and beads were washed with 500 ml washing buffer,
resuspended in Laemmli buffer and boiled for 2 min prior to performing western blotting experiments. Antibodies for RhoA, Rac1 and Cdc42 were provided with the kit and used according to the manufacturers protocol.
Cellular electrophysiology. Patch pipettes were pulled from borosilicate glass to a resistance of 35 MO. Currents were recorded, in whole-cell conguration, under voltage-clamp mode of the patch-clamp technique, at room temperature, using an Axopatch 200B patch clamp amplier (Axon Instrument, USA). Analogue signals were ltered at 5 kHz, and sampled at 10 kHz using a 1,440A Digidata converter. Cell capacitance and series resistance were electronically compensated by about 60%. The P/2 sub-pulse correction of cell leakage and capacitance was used to study Na current (INa). Sodium currents were recorded by depolarizing the cells from a holding potential of 100 mV to a maximal test pulse of 30 mV for
30 ms every 500 ms. The protocol used to build sodium currentvoltage (INaV)
relationships was as follows: from a holding potential of 100 mV, the membrane
was stepped to potentials from 80 to 60 mV, with 5-mV increments, for 50 ms
at a frequency of 2 Hz. Availabilityvoltage relationships were obtained by applying 50 ms prepulses using the INaV curve procedure followed by a depolarizing pulse to 5 mV for 50 ms. In this case, currents were normalized to the amplitude of the
test current without a prepulse. Conductance through Na channels (gNa) was calculated as already described21. Current amplitudes were normalized to cell capacitance and expressed as current density (pA/pF). The Physiological Saline Solution had the following composition (in mM): NaCl 140, KCl 4, MgCl2 1, CaCl2 2, D-glucose 11.1 and HEPES 10, adjusted to pH 7.4 with NaOH (1 M). The intrapipette solution had the following composition (in mM): KCl 130, NaCl 15, CaCl2 0.37, MgCl2 1, Mg-ATP 1, EGTA 1, HEPES 10, adjusted to pH 7.2 with
KOH (1 M).
Measurement of intracellular pH. Cells were incubated for 30 min at 37 C in Hanks medium containing 2 mM BCECF-AM (20,70-bis-(2-carboxyethyl)-5-(and-6)-carboxyuorescein; excitation 503/440 nm; emission 530 nm). Excess dye was removed by rinsing the cells twice with Physiological Saline Solution. H efux was measured as previously described25,59.
Cell viability. Cells were seeded at 4 104 cells per well in a 24-well plate and
were grown for a total of 5 days. Culture media were changed every day. Viable cell numbers were assessed by the tetrazolium salt assay as previously described24 and normalized to the appropriate control condition (MDA-MB-231-Luc or shCTL).
In vitro invasion assays. Cell invasiveness was analysed as previously described25 using culture inserts with 8-mm pore size lters covered with Matrigel (Becton Dickinson, France). Briey, the upper compartment was seeded with 6 104 cells
in DMEM supplemented with 5% FCS. The lower compartment was lled with DMEM supplemented with 10% FCS (or 15% FCS for non-small-cell lung and prostate cancer cells), as a chemoattractant. After 24 h at 37 C, remaining cells were removed from the upper side of the membrane. Cells that had invaded and migrated through the insert and were attached to the lower side were stained with
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 15
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
DAPI and counted on the whole area of the insert membrane. In vitro invasion assays were performed in triplicate in each separate experiment.
3D invasion assays. Five thousand shCTL or shSCN4B MDA-MB-231-luc cells were suspended in DMEM containing Matrigel (Corning; ref 356230, 2.7 mg ml 1 nal concentration), seeded in 96-well microplates and placed at 37 C, 5% CO2.
One hundred microlitres of DMEM 5% FBS were added in each well 30 min after
seeding. Time-lapse acquisitions (1 image per 30 min for a total duration of 48 h) were performed in the presence or absence of the MMP inhibitor GM6001 (10 mM nal concentration) to monitor 3D cancer cell invasiveness and started 4 h after cell seeding.
Epiuorescence imaging. For the assessment of ECM degradation, cells were cultured for 24 h on glass coverslips coated with a matrix composed of Matrigel (4 mg ml 1, nal concentration) and containing or not DQ-gelatin (25 mg ml 1,
Thermosher) as a uorogenic substrate of gelatinases. They were then washed in PBS, xed with 3.7% ice-cold paraformaldehyde in PBS. Cells were permeabilized with a solution containing 50 mM NH4Cl, 1% BSA and 0.02% saponin, then saturated in a solution containing 3% BSA and 3% normal goat serum . F-actin was stained with phalloidin-AlexaFluor594. Epiuorescence microscopy was performed with a Nikon TI-S microscope and analysed using both NIS-BR software (Nikon, France) and ImageJ software 1.38I (http://rsbweb.nih.gov/ij
Web End =http://rsbweb.nih.gov/ij). Pixels corresponding to the co-localization of F-actin condensation areas and focal spots of DQ-gelatin proteolysis (excitation wavelength: 495 nm, emission wavelength: 515 nm) were quantied per cell, giving a Matrix-focalized-degradation index.
Phospho (Y421)-cortactin was detected using the primary rabbit anti-pY421 cortactin antibody (Millipore) and the uorescent-conjugated secondary anti-rabbit TexasRed antibody (Thermosher). Pixels corresponding to the co-localization of phospho-cortactin and focal spots of DQ-gelatin proteolysis were quantied per cell using ImageJ software 1.38I.
For the assessment of cell morphology, cells were cultured for 24 h on glass coverslips and F-actin was stained with phalloidin-AlexaFluor594. A circularity index was calculated from pictures as being 4p area/perimeter2. A value
approaching 0 indicates an increasingly elongated shape while a value of 1.0 indicates a perfect circle.
Proximity ligation assays were performed according to the standard protocols26 using the Duolink-In-cell Co-IP kit (OLink Biosciences)60 using anti-SCN4B and Anti-RhoA primary antibodies.
Confocal imaging. 5,000 cells were seeded on Labtek coverslips (Thermosher) and placed in the incubator at 37 C, 5% CO2 for 24 h. They were then washed twice in PBS, xed with 3.7% ice-cold paraformaldehyde in PBS. Cells were permeabilized with a solution containing 50 mM NH4Cl, 1% BSA and 0.02%
saponin, then saturated in a solution containing 3% BSA and 3% normal goat serum. F-actin was stained with phalloidin-AlexaFluor488 (Thermosher).
Cells were observed on a confocal microscope, at 600 magnication (Olympus
Fluoview FV500 Laser Scanning Confocal Biological Microscope) and image acquisition was performed using Fluoview 500 v.5 software (Olympus, Tokyo, Japan).
Scanning electron microscopy. Cells were xed by incubation for 24 h in 4% paraformaldehyde, 1% glutaraldehyde in 0.1 M phosphate buffer (pH 7.2). They were then washed in PBS and post-xed by incubation with 2% osmium tetroxide for 1 h. Samples were then fully dehydrated in a graded series of ethanol solutions and dried in hexamethyldisilazane (HMDS; Sigma, USA). Finally, cells were coated with 40 platinum, using a GATAN PECS 682 apparatus (Pleasanton, USA), before observation under a Zeiss Ultra plus FEG-SEM scanning electron microscope (Oberkochen, Germany). Cells were pseudocolored using PowerPoint software (Microsoft, USA).
Zebrash invasion assays. Zebrash (Danio rerio), from the Zebrash International Resource Centre (ZIRC), were maintained in re-circulating tanks according to the standard procedures61. Adult shes were maintained at 26 C, with a light/dark cycle of 14/10 h, and were fed twice daily, once with dry ake food (PRODAC) and once with live Artemia salina (MC 450, IVE AQUACULTURE). Zebrash embryos were maintained in egg water at 28.5 C, fed for 5 days with NOVO TOM and with live A. salina at 11 days of life. All experiments were performed in compliance with the Guidelines of the European Union Council for animal experimentation (86/609/EU) and were approved by the Bioethical Committee of the University Hospital Virgen de la Arrixaca (Spain). The colonization of zebrash embryos was previously described35. Briey, MDA-MB-231 breast cancer cells transfected with siRNA targeting the expression of SCN4B gene (SiSCN4B) or null-target siRNA (siCTL) were trypsinized 24 h after transfection, washed and stained with the vital cell tracker red uorescent CM-Dil (Vibrant; Invitrogen). Fifty labelled cells were injected into the yolk sac of dechorionated zebrash embryos using a manual injector (Narishige). Fish with uorescently labelled cells appearing outside of the implantation area at 2 h post-injection were excluded from further analysis. All other shes were incubated at 35 C for 48 h and analysed with a SteReo Lumar V12 stereomicroscope equipped
with an AxioCam MR5 camera (Carl Zeiss). The evaluation criteria for embryos being colonized by human cancer cells was the presence of more than ve cells outside of the yolk sac. A zebrash (ZF) colonization index was calculated as being the proportion of embryos being colonized (by at least ve human cancer cells) in the siSCN4B condition divided by the proportion of invaded embryos in the siCTL condition.
Transendothelial migration/invasion. Human umbilical vein endothelial cell (HUVEC; Promocell, Germany) were cultured in medium 199 (1X; Gibco) containing 20% FCS, 100 mg ml 1 heparin and 50 mg ml 1 of endothelial cell growth supplement (Sigma-Aldrich) and were used up to the fth passage.
For transendothelial migration, 100,000 HUVEC were seeded in the upper side of 8-mm-pore sized transwell migration inserts (Corning, France) and grown for6 days. Endothelial culture medium was carefully removed and replaced by DMEM 10% FCS in the lower chamber and DMEM 5% FCS containing 60,000 MDA-MB-231 in the upper chamber. MDA-MB-231 cells were stained with4 ng ml 1 CM-Dil (Thermo Fisher Scientic) prior seeding.
For transendothelial invasion, matrigel-coated transwell invasion inserts were inverted in order to plate the bottom surface with 100,000 HUVEC for 4 h at 37 C, 5% CO2. Invasion chambers were then inverted again, inserted into a 24-well plates and HUVEC were cultured for 6 days in endothelial culture medium before plating MDA-MB-231 cells in the upper chamber. MDA-MB-231 cells were CM-Dil stained as described above. After 18 h of culture, transwells were washed in PBS and xed in formaldehyde 4% for 20 min.
Transendothelial electrical resistance measurements were recorded every day for 6 days until the transendothelial resistance was stable (410 kO) on the same transwells using an EVOM2 epithelial Voltohmmeter (World Precision Instruments, France).
In vivo tumour models. All animals were bred and housed at the In Vivo platform of the Cancrople Grand Ouest at Inserm U892 (Nantes, France) under the animal care license no. 44278. The project was approved by the French national ethical committee (APAFIS 00085.01).
Unanaesthetized six-week-old female NMRI Nude Mice (Charles River Laboratories) were placed into a plastic restraining device, and 2 106 MDA-MB-
231-Luc cells (shSCN4B, 7 mice/oeSCN4B, 8 mice) suspended in 100 ml PBS were injected into the lateral tail vein through a 25-gauge needle as previously described22. At necropsy, ex vivo BLI measurement for each collected organ was performed within 15 min of D-luciferin intraperitoneal injection (150 mg kg 1).
Photons emitted by cancer cells were counted by bioluminescent imaging (FimagerTM; BIOSPACE Lab) and expressed in counts per minute (c.p.m.).
Six-week-old female Rag2 / Il2rg / mice (NOD SCID; Charles River
Laboratories) were injected into the sixth right inguinal mammary fat pad with 2 106 MDA-MB-231-Luc cells (shSCN4B or oeSCN4B, 8 mice per group)
suspended in 100 ml PBS while under isourane anaesthesia. Tumour growth was monitored by bioluminescence imaging22. Animal weight was measured every week or every other week, and the primary tumour volume (mm3) was measured with a calliper and calculated as length height width (in mm). Mice were
euthanized 24 weeks following implantation of tumour cells and metastatic bioluminescence was measured22.
Statistical analyses. Statistical analyses on immunohistochemistry staining were performed using the Yates w2 test using the online interactive Chi-square test software Quantpsy (http://www.quantpsy.org/chisq/chisq.htm). Other data were displayed as means.e.m. and n sample size, and were analysed using para
metric statistical tests (Students t-test or ANOVA) when they followed a normal distribution and equal variances. Alternatively, when samples did not follow a normal distribution, or when variances failed to be comparable, data were displayed as box plots indicating the rst quartile, the median and the third quartile, and squares for comparison of means. In these cases, adequate non-parametric statistical tests were used (MannWhitney rank sum tests, Dunns tests, ANOVA on ranks). Statistical analyses were performed using SigmaStat 3.0 software (Systat software Inc.) and statistical signicance is indicated as *Po0.05; **Po0.01 and ***Po0.001. NS stands for not statistically different.
Data availability. Expression of SCNxB genes in cancer tissues was studied using the web-based The Cancer Genome Atlas (http://cancergenome.nih.gov
Web End =http://cancergenome.nih.gov). The authors declare that all other data supporting the ndings of this study are available within the paper and its Supplementary Information les or available from the authors upon request.
References
1. Parkin, D. M., Bray, F., Ferlay, J. & Pisani, P. Global cancer statistics, 2002. CA Cancer J. Clin. 55, 74108 (2005).
2. Fidler, I. J. Understanding bone metastases: the key to the effective treatment of prostate cancer. Clin. Adv. Hematol. Oncol. 1, 278279 (2003).
3. Friedl, P. & Alexander, S. Cancer invasion and the microenvironment: plasticity and reciprocity. Cell 147, 9921009 (2011).
4. Linder, S., Wiesner, C. & Himmel, M. Degrading devices: invadosomes in proteolytic cell invasion. Annu. Rev. Cell Dev. Biol. 27, 185211 (2011).
16 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648 ARTICLE
5. Brisson, L., Reshkin, S. J., Gore, J. & Roger, S. pH regulators in invadosomal functioning: proton delivery for matrix tasting. Eur. J. Cell Biol. 91, 847860 (2012).
6. Wolf, K. & Friedl, P. Extracellular matrix determinants of proteolytic and non-proteolytic cell migration. Trends Cell Biol. 21, 736744 (2011).
7. Sanz-Moreno, V. et al. Rac activation and inactivation control plasticity of tumor cell movement. Cell 135, 510523 (2008).
8. Sahai, E. & Marshall, C. J. Differing modes of tumour cell invasion have distinct requirements for Rho/ROCK signalling and extracellular proteolysis. Nat. Cell Biol. 5, 711719 (2003).
9. Wyckoff, J. B., Pinner, S. E., Gschmeissner, S., Condeelis, J. S. & Sahai, E. ROCK- and myosin-dependent matrix deformation enables protease-independent tumor-cell invasion in vivo. Curr. Biol. 16, 15151523 (2006).
10. Friedl, P. & Wolf, K. Tumour-cell invasion and migration: diversity and escape mechanisms. Nat. Rev. Cancer 3, 362374 (2003).
11. Wolf, K. et al. Compensation mechanism in tumor cell migration: mesenchymal-amoeboid transition after blocking of pericellular proteolysis.J. Cell Biol. 160, 267277 (2003).12. Goldin, A. L. et al. Nomenclature of voltage-gated sodium channels. Neuron 28, 365368 (2000).
13. Catterall, W. A. Voltage-gated sodium channels at 60: structure, function, and pathophysiology. J. Physiol. 590, 25772589 (2012).
14. OMalley, H. A. & Isom, L. L. Sodium channel beta subunits: emerging targets in channelopathies. Annu. Rev. Physiol. 77, 481504 (2015).
15. Black, J. A. & Waxman, S. G. Noncanonical roles of voltage-gated sodium channels. Neuron 80, 280291 (2013).
16. Besson, P. et al. How do voltage-gated sodium channels enhance migration and invasiveness in cancer cells? Biochim. Biophys. Acta 1848, 24932501 (2015).
17. Roger, S., Gillet, L., Le Guennec, J. Y. & Besson, P. Voltage-gated sodium channels and cancer: is excitability their primary role? Front. Pharmacol. 6, 152 (2015).
18. Brackenbury, W. J. Voltage-gated sodium channels and metastatic disease. Channels (Austin) 6, 352361 (2012).
19. Yang, M. et al. Therapeutic potential for phenytoin: targeting Nav1.5 sodium channels to reduce migration and invasion in metastatic breast cancer. Breast Cancer Res. Treat. 134, 603615 (2012).
20. Fraser, S. P. et al. Voltage-gated sodium channel expression and potentiation of human breast cancer metastasis. Clin. Cancer Res. 11, 53815389 (2005).21. Roger, S., Besson, P. & Le Guennec, J. Y. Involvement of a novel fast inward sodium current in the invasion capacity of a breast cancer cell line. Biochim. Biophys. Acta 1616, 107111 (2003).
22. Driffort, V. et al. Ranolazine inhibits Nav1.5-mediated breast cancer cell invasiveness and lung colonization. Mol. Cancer 13, 264 (2014).
23. Nelson, M., Yang, M., Dowle, A. A., Thomas, J. R. & Brackenbury, W. J. The sodium channel-blocking antiepileptic drug phenytoin inhibits breast tumour growth and metastasis. Mol. Cancer 14, 13 (2015).
24. Gillet, L. et al. Voltage-gated sodium channel activity promotes cysteine cathepsin-dependent invasiveness and colony growth of human cancer cells.J. Biol. Chem. 284, 86808691 (2009).25. Brisson, L. et al. NaV1.5 enhances breast cancer cell invasiveness by increasing NHE1-dependent H( ) efux in caveolae. Oncogene 30, 20702076 (2011).
26. Brisson, L. et al. Nav1.5 Na channels allosterically regulate the NHE-1 exchanger and promote the activity of breast cancer cell invadopodia. J. Cell Sci.
126, 48354842 (2013).27. Nelson, M., Millican-Slater, R., Forrest, L. C. & Brackenbury, W. J. The sodium channel beta1 subunit mediates outgrowth of neurite-like processes on breast cancer cells and promotes tumour growth and metastasis. Int. J. Cancer 135, 23382351 (2014).
28. Yu, F. H. et al. Sodium channel beta4, a new disulde-linked auxiliary subunit with similarity to beta2. J. Neurosci. 23, 75777585 (2003).
29. Medeiros-Domingo, A. et al. SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome. Circulation 116, 134142 (2007).
30. Tan, B. H. et al. Sudden infant death syndrome-associated mutations in the sodium channel beta subunits. Heart Rhythm 7, 771778 (2010).
31. Okayama, H. et al. Identication of genes upregulated in ALK-positive and EGFR/KRAS/ALK-negative lung adenocarcinomas. Cancer Res. 72, 100111 (2012).
32. Hou, J. et al. Gene expression-based classication of non-small cell lung carcinomas and survival prediction. PLoS ONE 5, e10312 (2010).
33. Chioni, A. M., Brackenbury, W. J., Calhoun, J. D., Isom, L. L. & Djamgoz, M. B. A novel adhesion molecule in human breast cancer cells: voltage-gated Na channel beta1 subunit. Int. J. Biochem. Cell Biol. 41, 12161227 (2009).
34. Marques, I. J. et al. Metastatic behaviour of primary human tumours in a zebrash xenotransplantation model. BMC Cancer 9, 128 (2009).
35. Jelassi, B. et al. P2X(7) receptor activation enhances SK3 channels- and cystein cathepsin-dependent cancer cells invasiveness. Oncogene 30, 21082122 (2011).
36. Roger, S., Guennec, J. Y. & Besson, P. Particular sensitivity to calcium channel blockers of the fast inward voltage-dependent sodium current involved in the invasive properties of a metastastic breast cancer cell line. Br. J. Pharmacol. 141, 610615 (2004).
37. Wannous, R. et al. Suppression of PPARbeta, and DHA treatment, inhibit NaV1.5 and NHE-1 pro-invasive activities. Pugers Arch. 467, 12491259 (2015).
38. Jarvis, M. F. et al. A-803467, a potent and selective Nav1.8 sodium channel blocker, attenuates neuropathic and inammatory pain in the rat. Proc. Natl. Acad. Sci. USA 104, 85208525 (2007).
39. Roger, S. et al. Voltage-gated sodium channels potentiate the invasive capacities of human non-small-cell lung cancer cell lines. Int. J. Biochem. Cell Biol. 39, 774786 (2007).
40. Diss, J. K., Archer, S. N., Hirano, J., Fraser, S. P. & Djamgoz, M. B. Expression proles of voltage-gated Na channel alpha-subunit genes in rat and human prostate cancer cell lines. Prostate 48, 165178 (2001).
41. Saltel, F. et al. Invadosomes: intriguing structures with promise. Eur. J. Cell Biol. 90, 100107 (2011).
42. Kovacs, M., Toth, J., Hetenyi, C., Malnasi-Csizmadia, A. & Sellers, J. R. Mechanism of blebbistatin inhibition of myosin II. J. Biol. Chem. 279, 3555735563 (2004).
43. Messner, D. J. & Catterall, W. A. The sodium channel from rat brain. Separation and characterization of subunits. J. Biol. Chem. 260, 1059710604 (1985).
44. Qin, N. et al. Molecular cloning and functional expression of the human sodium channel beta1B subunit, a novel splicing variant of the beta1 subunit. Eur. J. Biochem. 270, 47624770 (2003).
45. Brackenbury, W. J. & Isom, L. L. Na channel beta subunits: overachievers of the ion channel family. Front. Pharmacol. 2, 53 (2011).
46. McCormick, K. A. et al. Molecular determinants of Na channel function in the extracellular domain of the beta1 subunit. J. Biol. Chem. 273, 39543962 (1998).
47. Meadows, L., Malhotra, J. D., Stetzer, A., Isom, L. L. & Ragsdale, D. S. The intracellular segment of the sodium channel beta1 subunit is required for its efcient association with the channel alpha subunit. J. Neurochem. 76, 18711878 (2001).
48. Chen, C. et al. Identication of the cysteine residue responsible for disulde linkage of Na channel alpha and beta2 subunits. J. Biol. Chem. 287, 3906139069 (2012).
49. Gilchrist, J., Das, S., Van Petegem, F. & Bosmans, F. Crystallographic insights into sodium-channel modulation by the beta4 subunit. Proc. Natl. Acad. Sci. USA 110, E5016E5024 (2013).
50. Calhoun, J. D. & Isom, L. L. The role of non-pore-forming beta subunits in physiology and pathophysiology of voltage-gated sodium channels. Handb. Exp. Pharmacol. 221, 5189 (2014).
51. Lenkowski, P. W., Shah, B. S., Dinn, A. E., Lee, K. & Patel, M. K. Lidocaine block of neonatal Nav1.3 is differentially modulated by co-expression of beta1 and beta3 subunits. Eur. J. Pharmacol. 467, 2330 (2003).
52. Zhang, M. M. et al. Co-expression of Navb subunits alters the kinetics of inhibition of voltage-gated sodium channels by pore-blocking mu-conotoxins. Br. J. Pharmacol. 168, 15971610 (2013).
53. Wilson, M. J. et al. Navb subunits modulate the inhibition of Nav1.8 by the analgesic gating modier muO-conotoxin MrVIB. J. Pharmacol. Exp. Ther. 338, 687693 (2011).
54. Isom, L. L. Sodium channel beta subunits: anything but auxiliary. Neuroscientist 7, 4254 (2001).
55. Isom, L. L. & Catterall, W. A. Na channel subunits and Ig domains. Nature 383, 307308 (1996).
56. Isom, L. L. The role of sodium channels in cell adhesion. Front. Biosci. 7, 1223 (2002).
57. Hernandez-Plata, E. et al. Overexpression of Nav1.6 channels is associated with the invasion capacity of human cervical cancer. Int. J. Cancer. 130, 20132023 (2012).
58. Jezequel, P. et al. bc-GenExMiner: an easy-to-use online platform for gene prognostic analyses in breast cancer. Breast Cancer Res. Treat. 131, 765775 (2012).
59. Gore, J., Besson, P., Hoinard, C. & Bougnoux, P. Na( )-H antiporter activity in relation to membrane fatty acid composition and cell proliferation. Am. J.
Physiol. 266, C110C120 (1994).60. Soderberg, O. et al. Direct observation of individual endogenous protein complexes in situ by proximity ligation. Nat. Methods 3, 9951000 (2006).
61. Westereld, M. The Zebrash Book: A Guide for the Laboratory Use of Zebrash (Danio rerio) 5th edn (Univ. Oregon Press, 2007)..
Acknowledgements
This work was supported by the Ministre de la Recherche et des Technologies, the
Inserm, the Ligue Nationale Contre le CancerInterrgion Grand-Ouest, the Rgion
NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications 17
ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/ncomms13648
Centre (grant NaVMetarget, project ARD2020 Biomdicaments) and the Association
CANCEN. J.L.G.-P. was supported by Le Studium. We thank Mrs Catherine Le Roy for
secretary and administrative assistance, and Dr Armelle Vinceneux for her help with IHC
staining of b4 in human breast normal tissues. We thank Prof. Stephan J. Reshkin
(University of Bari, Italy), Dr Lin-Hua Jiang (University of Leeds, UK) and Dr Philippe
Chavrier (Institut Curie, France) for their critical reading of the manuscript.
Author contributions
All authors contributed extensively to the work presented in this study. E.B. performed
and analysed immunouorescence imaging, time-lapse microscopy experiments, assessed
cell adhesion and transendothelial migration. E.B., V.D. and F.G. performed cell culture,
molecular and cellular biology experiments, assessed cell viability, migration and
invasion. E.B., V.D., M.A. and M.-L.C. performed zebrash experiments. I.D. partici
pated to cell culture. C.M.-C. and P.P. performed and analysed immunohistochemical
experiments on tissue microarrays, and R.G. and G.F. on mice tissues. S.M.-L. and T.O.
performed mice experiments, E.B., S.R., S.C. and P.B. analysed in vivo data. E.B., V.D.,
E.P. and A.M. participated to lentiviral particles production and the generation of small
hairpin RNA or overexpressing cancer cell lines. S.R performed electrophysiology
experiments. E.B., F.G. and J.B.-G. performed scanning electron microscopy experiments.
J.B.-G. and S.R. performed in silico expression analyses. P.G.F. contributed in discussion
and correction of the manuscript. S.R., S.C. and P.B. obtained research grants, directed
the research, designed the study, analysed the data and wrote the manuscript.
Additional information
Supplementary Information accompanies this paper at http://www.nature.com/naturecommunications
Web End =http://www.nature.com/
http://www.nature.com/naturecommunications
Web End =naturecommunications Competing nancial interests: The authors declare no competing nancial interests. Reprints and permission information is available online at http://npg.nature.com/reprintsandpermissions/
Web End =http://npg.nature.com/
http://npg.nature.com/reprintsandpermissions/
Web End =reprintsandpermissions/
How to cite this article: Bon, E. et al. SCN4B acts as a metastasis-suppressor gene
preventing hyperactivation of cell migration in breast cancer. Nat. Commun. 7, 13648
doi: 10.1038/ncomms13648 (2016).
Publishers note: Springer Nature remains neutral with regard to jurisdictional claims in
published maps and institutional afliations.
This work is licensed under a Creative Commons Attribution 4.0
International License. The images or other third party material in this
article are included in the articles Creative Commons license, unless indicated otherwise
in the credit line; if the material is not included under the Creative Commons license,
users will need to obtain permission from the license holder to reproduce the material.
To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
Web End =http://creativecommons.org/licenses/by/4.0/
r The Author(s) 2016
18 NATURE COMMUNICATIONS | 7:13648 | DOI: 10.1038/ncomms13648 | http://www.nature.com/naturecommunications
Web End =www.nature.com/naturecommunications
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
Copyright Nature Publishing Group Dec 2016
Abstract
The development of metastases largely relies on the capacity of cancer cells to invade extracellular matrices (ECM) using two invasion modes termed 'mesenchymal' and 'amoeboid', with possible transitions between these modes. Here we show that the SCN4B gene, encoding for the β4 protein, initially characterized as an auxiliary subunit of voltage-gated sodium channels (NaV ) in excitable tissues, is expressed in normal epithelial cells and that reduced β4 protein levels in breast cancer biopsies correlate with high-grade primary and metastatic tumours. In cancer cells, reducing β4 expression increases RhoA activity, potentiates cell migration and invasiveness, primary tumour growth and metastatic spreading, by promoting the acquisition of an amoeboid-mesenchymal hybrid phenotype. This hyperactivated migration is independent of NaV and is prevented by overexpression of the intracellular C-terminus of β4. Conversely, SCN4B overexpression reduces cancer cell invasiveness and tumour progression, indicating that SCN4B/β4 represents a metastasis-suppressor gene.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer




