1. Introduction
A copious amount of literature links basic leucine zipper transcription factors, ATF5, CEBPB and CEBPD, to tumor formation, growth, metastasis and treatment resistance in a variety of cancers [1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29]. Nevertheless, as with many other transcription factors, few options exist to successfully directly target them for therapeutic purposes.
In the past, we developed the strategy of generating an inducible or cell-penetrating dominant-negative (dn) peptide form of ATF5 for cancer treatment [2,4,30,31,32,33]. This exploited the requirement of leucine zipper proteins to form homo- and/or heterodimers to regulate transcription [34,35,36]. In this context, dn peptides containing specified leucine zipper sequences, but lacking DNA-binding capacity, associated with obligate dimerization partners to form inactive species, thereby effectively sequestering them and interfering with function [33,36]. To permit such dn peptides to enter cells and pass tissue barriers, we fused them with a penetratin domain [31,37]. The resulting cell-penetrating dn peptide for ATF5, CP-dn-ATF5, inhibits survival/growth of a wide variety of cultured tumor cell types and blocks or slows tumor growth and prolongs survival in multiple mouse cancer models [31,32,33]. Pull-down/mass spectrometry studies designed to uncover dn-ATF5′s binding targets have revealed its association with CEBPB and CEBPD, but not with ATF5 itself [33]. Such findings suggest that alternative means of interfering with CEBPB and CEBPD function as well as that of ATF5 would be of potential therapeutic value for cancer treatment.
CEBPB and CEBPD form homodimers and heterodimerize with one another via their leucine zippers [34,35,36]. Our interaction studies indicate that unlike ATF5 itself, they also form leucine-zipper-dependent heterodimers with ATF5 [33]. Taken together, these considerations suggest that leucine-zipper-based dn-forms of CEBPB and CEBPD would not only directly interfere with CEBPB and CEBPD signaling, but also (unlike dn-ATF5) with ATF5 signaling as well. This prompted us to design and assess cell-penetrating dn decoy forms of CEBPB and CEBPD in the context of cancer treatment. Here, we have examined their in vitro and in vivo actions on multiple cancer types, selectivity for killing transformed cells, effects on cancer cell migration, capacity to act in combination with other cancer therapeutics, interference with transcription of known direct CEBPB, CEBPD and ATF5 targets and distal mechanisms of action by which they kill malignant cells.
2. Materials and Methods
2.1. Cell Culture, Peptides and siRNA Treatment
T98G, LN229, U251, MDA-MB-231, MCF7, MDA-MB-468, A549, HCT116, A375, MeWo, HEK293T and B16-F10 cells were from, and authenticated by, the ATCC. T98G Taxol-resistant cells were established by continuous exposure to incremental Taxol concentrations up to 1 nM. Mgpp3 cells were the kind gift of Dr. Peter Canoll, Columbia University [38]. Cells were grown in DMEM supplemented with 10% FBS and 100 U/mL Penicillin–Streptomycin. HAP1 WT and ATF5KO-1 cells were from Horizon Discovery and authenticated and grown as previously described [33]. Human astrocytes and astrocyte growth medium were from Sciencell Research Laboratories and authenticated by the supplier. MCF10A and HIEC-6 cells were gifts of Drs. Eileen Connolly and Alejandro Chavez (Columbia University, New York, NY, USA), respectively, and cultured and authenticated as described previously [39]. Unless otherwise specified, for experiments concerning cell number, survival or protein/mRNA expression, cells were seeded into 48- or 6-well tissue culture plates precoated with a 0.1 µg/µL poly-D-lysine solution overnight and then air-dried for 15 min.
Bpep, Dpep and mutated peptides were purchased as acetate salts either from CSBio or AlanScientific with the following sequences:
Bpep: RQIKIWFQNRRMKWKKLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQL
Dpep: RQIKIWFQNRRMKWKKLVELSAENEKLHQRVEQLTRDLAGLRQFFK
Dpep-mut: RQIKIWFQNRRMKWKKLVEGSAENEKGHQRVEQGTRDGAGGRQFFK
The peptides were dissolved in 10% glycerol in PBS, pH 7.2 and stored as 2 mM aliquots at −80 °C prior to final dilution for experiments.
siRNA: Silencer™ Select (Invitrogen): Negative Control No. 2 siRNA (439084), BMF siRNA s40386 (#4392420), or BMF siRNA s40387 (#4392420) were transfected into 50% confluent cultures using Oligofectamine™ (Invitrogen, Carlsbad, CA, USA) following the supplier’s protocol.
2.2. Cell Viability
Cells were seeded in 48-well plates at 1 × 104/well in 0.2 mL of growth medium. Following overnight incubation, cells were refreshed with DMEM with 2% FBS and the indicated concentrations of Bpep or Dpep and other indicated additives. Cell viability was assessed after 6 days or as indicated by cell counting using either a hemocytometer or a Countess II automated cell counter (Life Technologies, Carlsbad, CA, USA). Assays were performed in triplicate.
2.3. Colony Formation Assays
Cells were seeded in 6-well plates (200 cells/well) and treated with indicated doses of Bpep or Dpep for 12 days. At the treatment end, colonies were fixed, stained with 0.5% crystal violet and 25% methanol in PBS for 30 min, washed with PBS and quantified. Colonies were defined as containing at least 50 cells. Soft agar colony-forming assays were established in 6-well plates as described [40]. 5 × 103 cells were seeded with specified concentrations of Bpep or Dpep and indicated additives. After 12 days, total colonies were counted.
2.4. Plasmids
Fragments encoding wild-type and mutant DN-CEBPB or DN-CEBPD were subcloned into the 5′-BamHI site and the 3′-XhoI site of pCMV-3Tag-2A (Agilent Technologies) plasmid for in-frame 3xMyc-tagged expression. The sequences of the fragments were:
pCMV-3Tag2A-DN-CREBP/B:
MEQKLISEEDLEQKLISEEDLEQKLISEEDLARAGSMASMTGGQQMGRDPDLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQL
pCMV-3Tag2A-DN-CEBP/D:
MEQKLISEEDLEQKLISEEDLEQKLISEEDLARAGSMASMTGGQQMGRDPDLVELSAENEKLHQRVEQLTRDLAGLRQFFK
pCMV-3Tag2A-DN-CREBP/B-mut:
MEQKLISEEDLEQKLISEEDLEQKLISEEDLARAGSMASMTGGQQMGRDPDGETQHKVGEGTAENERGQKKVEQGSREGSTGRNGFKQG
pCMV-3Tag2A-DN-CEBP/D-mut:
MEQKLISEEDLEQKLISEEDLEQKLISEEDLARAGSMASMTGGQQMGRDPDGVEGSAENEKGHQRVEQGTRDGAGGRQFFK
2.5. Transfection Assays of WT and Mutant DN-CEBPB or DN-CEBPD
Cells were seeded in 48-well plates in triplicate overnight to reach 70–90% confluency. Cultures were transfected with 0.2 µg DNA/well using Lipofectamine™ 3000 (Invitrogen) following the supplier’s protocols. 48 h later, cells were fixed in 4% PFA for 10 min, treated with 0.3% Triton-X for 5 min and blocked with Superblock (Thermo Fisher, Rockford, IL, USA) for 30 min at room temperature. Cells were then incubated with mouse anti-myc (Cell Signaling Technology, Danvers, MA, USA) for 1 h, washed with PBS and incubated with the secondary antibody for another hour. Cultures were stained with Hoechst 33342 to detect total cells and apoptotic nuclei. Images were acquired using a Zeiss epifluorescence microscope with a digital camera and Axiovision software. The proportion of cells with apoptotic nuclei was quantified by scoring all transfected cells from 4 random fields for each sample.
2.6. Annexin V-FITC/PI Double Staining Assay
Apoptosis was evaluated using the FITC Annexin V Apoptosis Detection Kit I (BD Biosciences) using the supplier’s protocol, followed by analysis in the Columbia HICCC flow Cytometry Core.
2.7. qPCR
Cells were seeded in 6-well plates, treated with 20 µM Bpep or Dpep for 48 h and lysed. Total RNA purification, cDNA synthesis and qPCR were carried out as previously described [33]. Primer pairs were:
18S ribosomal RNA Forward primer: 5′-AGTCCCTGCCCTTTGTACACA-3′
18S ribosomal RNA Reverse primer: 5′-GATCCGAGGGCCTCACTAAAC-3′
IL6 Forward primer: 5′-CCAGAGCTGTGCAGATGAGTA-3′
IL6 Reverse primer: 5′-TGGGTCAGGGGTGGTTATTG-3′
IL8 Forward primer: 5′-CTCTTGGCAGCCTTCCTGATT-3′
IL8 Reverse primer: 5′-TATGCACTGACATCTAAGTTCTTTAGC-3′
BMF Forward primer: 5′-CCACCAGCCAGGAAGACAAAG-3′
BMF Reverse primer: 5′-TGCTCCCCAATGGGCAAGACT-3′
ASNS Forward primer: 5′-CTGTGAAGAACAACCTCAGGATC-3′
ASNS Reverse primer: 5′-AACAGAGTGGCAGCAACCAAGC-3′
2.8. Western Immunoblotting
Cells were seeded into 6-well dishes, treated with 20 µM Bpep or Dpep for 72 h and processed for Western immunoblotting and imaging as previously described [33]. Antibodies used were: rabbit anti-survivin (Cell Signaling Technology, Danvers, MA, USA #2808), rabbit anti-MCL-1 (Cell Signaling Technology, Danvers, MA, USA #94296s), rabbit anti-BCL-2 (Cell Signaling Technology, Danvers, MA, USA #15071s) and mouse anti-ACTIN (Cell Signaling Technology, Danvers, MA, USA #3700).
2.9. Migration Scratch Assay
Cells were seeded in 6-well plates to form monolayers and were either pretreated or not with 20 µM Bpep or Dpep for 20 h. Scratches were made with a 200 μL pipette tip. Cells were then treated for another 20 h. Images were taken at 0 and 20 h for determination of scratch widths.
2.10. Mouse Tumor Models
Animal procedures were approved by the Columbia University IACUC (protocol AC-AABE2555) and followed guidelines set forth by the National Institutes of Health guide for care and use of laboratory animals. 1 × 106 A375 HCT116 or B16-F10 cells were implanted subcutaneously into flanks of 6–8 week-old female NCR nude mice (Taconic, Rensselaer, NY, USA) or C57BL/6 mice (Taconic, Rensselaer, NY, USA), respectively. Each mouse received three implantations. When tumors reached 100–200 mm3, mice were randomized into different groups and treated intraperitoneally with 100 µL/mouse of vehicle or peptides 3–4 times/week as indicated. The amount of peptide per treatment ranged between 10–50 mg/kg as indicated in Figures and Figure legends. Tumor sizes were measured with calipers and calculated as (length × width2)/2. Body weights were monitored at each time point. For survival studies, mice were sacrificed once a single tumor reached a preset endpoint of 1000 mm3. H&E and TUNEL staining of harvested tumors were conducted by the Columbia University Molecular Pathology facility.
2.11. Statistical Analyses
All experiments were performed at least in triplicate. Data are expressed as mean ± SEM. Statistical significance was calculated using a two-tailed Student’s t-test or ANOVA (for multiple comparisons). IC50 values were calculated by non-linear regression.
3. Results
3.1. dn-CEBPB and -CEBPD Expression Compromises Cancer Cell Survival
To test the hypothesis that dn-decoy forms of CEBPB and CEBPD kill cancer cells, we transfected T98G glioblastoma cells with vectors expressing myc-tagged CEBPB or CEBPD leucine zipper sequences, or tag alone. Assessment of transfected cell nuclei after 3 days revealed that both dn constructs caused significant apoptosis compared with the control (Figure 1A). As an additional control, we transfected T98G and HCT116 colon cancer cells with the constructs as well as with constructs in which the heptad repeat leucines in the CEBPB and CEBPD leucine zippers were replaced with glycines. The dn constructs significantly increased apoptosis compared with the mutant forms, indicating a requirement for the intact leucine zipper as well as an absence of non-specific toxicity (Figure 1B).
3.2. Cell-Penetrating dn-CEBPB and dn-CEBPD Peptides Compromise Growth/Survival of Multiple Cancer Cell Lines
We next designed cell-penetrating peptide forms of dn-CEBPB and dn-CEBPD, containing a cell penetrating penetratin domain followed by the leucine zipper sequence of the corresponding proteins. We will henceforth refer to these peptides as Bpep and Dpep, respectively. While the peptides were freely soluble in PBS + 10% glycerol at 2 mM, in a culture medium containing 2% or greater fetal bovine serum, there was minor precipitation at 50 µM that increased with elevated concentrations. Dose-response experiments carried out for 6 days revealed that both peptides inhibited growth/survival of multiple cancer cell lines with 50% efficacy (IC50) generally in the range of 10–30 µM. Assessed cancer types included glioblastoma (T98G, LN229, U251, murine MGPP3), melanoma (A375, MeWo, murine B16), breast (MDA-MB-231, MCF7, MDA-MB-468), lung adenocarcinoma (A549), colon cancer (HCT116), myelogenous leukemia (HAP1) and transformed embryonic kidney cells (293T) (Figure 1C,D; Supplementary Figures S1A and S2A). A time course with T98G cells revealed that peptide effects were detectable by day 1 and continued through 6 days of exposure (Figure 1E).
Dose-responses for Bpep and Dpep were generally similar, but not identical across multiple lines, raising the question of whether the two might act additively or synergistically. Multiple lines were exposed to various concentrations of Bpep or Dpep alone or in a 1:1 combination and assessed for growth/survival. The outcome (Supplementary Figure S1B) indicates the two peptides act near-additively (with calculated Combination Indexes (CI) of 0.91 ± 0.07, 0.9 ± 0.11, 0.93 ± 0.08 and 0.91 ± 0.17, respectively), suggesting they target the same or similar pathways.
Bpep and Dpep were designed to interact with targets by specific leucine-zipper interactions. To confirm the importance of this interaction and to rule out non-specific toxicity, parallel assays were carried out on multiple lines with unmodified peptides and with Dpep mutated to replace heptad repeat leucines in the leucine zipper with glycine residues. The outcome showed a greatly decreased potency of the modified peptides, indicating reliance on the intact leucine zipper for full activity (Figure 1D; Supplementary Figure S1C).
An important question is whether Bpep/Dpep effects on cell survival/growth are selective for cancer cells. To assess this as well as possible non-specific toxicity, non-transformed cells including primary astrocytes, MCF10A breast cells and HIEC-6 intestinal epithelial cells were treated with the peptides. No effects were observed on survival/growth at up to 50 µM for 6 days of treatment, indicating an absence of activity or toxicity on normal cells (Figure 1F, Supplementary Figure S2B). These observations also suggest that the minor activity of the mutated peptides on cancer cells reflects a low level of residual target binding rather than toxicity.
In addition to assessing peptide effects in monolayer cultures, we evaluated their actions in colony-forming assays in soft-agar and on culture dishes, conditions that may more closely model in vivo growth and metastasis. In both models, Bpep and Dpep suppressed colony formation by multiple lines with IC50′s in the 500 nM range and efficacies of 75–97% at 5 µM (Figure 2A, Supplementary Figure S3A).
While experiments with Bpep and Dpep indicated an apoptotic response, we directly evaluated this by flow cytometry of PI/Annexin V-stained cancer lines treated with or without 20 µM Bpep or Dpep for 3 days. This revealed substantial peptide-stimulated increases in apoptosis (Figure 2B; Supplementary Figure S3B). In contrast, treated non-transformed intestinal HIEC-6 epithelial cells showed no increase in apoptosis (Figure 2B). To confirm the apoptotic response of cancer cells, we also performed flow analysis of sub-G1 DNA levels in multiple PI-stained lines with or without 3-days’ treatment with 20 µM Bpep or Dpep. This too showed that the peptides elicit a substantial apoptosis (Figure 2C).
ATF5, CEBPB and CEBPD are reported to promote tumor cell migration and metastasis [11,13,23,25]. To assess whether our peptides would suppress this activity, we performed migration assays in which T98G and MDA-MB-231 cultures were subjected to scratches and assessed 20 h later (a time with little cell death with the peptides) for cell movement into the gap with or without Bpep or Dpep. In both lines, the peptides significantly inhibited migration (Figure 2D). Inhibition was also observed in MDA-MB-231 cultures pretreated with the peptides for 20 h, scratched and assessed for gap size for 20 h (Supplementary Figure S3C).
3.3. Bpep and Dpep Act in Combination with Other Cancer Therapeutics
We next assessed Bpep and Dpep actions in combination with multiple presently employed cancer therapeutics. We were particularly interested to learn whether the peptides might interfere with other therapies, or act additively or synergistically with them, and whether they would act on cells resistant to such therapies.
ATF5, CEBPB and CEBPD have been reported to contribute to cancer cell radiation resistance [12,14,24]. To assess Bpep and Dpep in combination with radiation treatment, T98G and HCT116 cells (representing cancer types treated with radiotherapy) were either co-exposed to gamma radiation and the peptides, or irradiated and one day later subjected to peptide treatment. In both cases, comparison with untreated and monotherapy-treated cells indicated that the peptides did not preclude response to radiation and (as seen in normalized plots) that the peptides acted approximately additively to somewhat synergistically with radiation to suppress tumor cell growth/survival (co-treatment: T98G, CI = 0.74 ± 0.04 for Bpep, 0.84 ± 0.07 for Dpep; HCT116, CI = 0.93 ± 0.06 for Bpep, 0.92 ± 0.08 for Dpep. Radiation pre-treatment: T98G, CI = 0.61 ± 0.05 for Bpep, 0.68 ± 0.07 for Dpep; HCT116, 0.89 ± 0.04 for Bpep, 0.86 ± 0.05 for Dpep) (Figure 3A; Supplementary Figure S4A). Similar results were achieved with Dpep and T98G cells as determined by colony formation in soft agar (Supplementary Figure S4B). Although there were too few points to calculate a CI value, an apparent synergistic effect was particularly evident in the combination of 5 µM peptide with 5 Gy.
Past studies [10,19,27] have implicated ATF5, CEBPB and CEBPD in the regulation of cancer cell responsiveness to the microtubule-targeting drug Taxol (paclitaxel), which is used to treat breast and other tumor types. We therefore compared responses of MCF7 and triple negative MDA-MB-231 breast cancer cells to Taxol either alone or in combination with Dpep and Bpep. The peptides acted with apparent synergism with Taxol on both lines to inhibit growth/survival (MCF7: CI = 0.41 ± 0.04 for Bpep; 0.44 ± 0.04 for Dpep. MDA-MB-231: 0.74 ± 0.03 for Bpep; 0.74 ± 0.05 for Dpep) (Supplementary Figure S5A). Soft agar colony-formation assays with MDA-MB-231 cells showed a similar activity of the combination treatment (Figure 3B). Taxol has been advocated as a potential treatment for glioblastoma [41]. The combination of Bpep and Dpep with Taxol on T98G cells also showed apparent synergy (CI = 0.84 ± 0.06 for Bpep and 0.75 ± 0.07 for Dpep) (Supplementary Figure S5A).
Taxol resistance represents an important clinical challenge [42]. To determine whether the peptides act in this context, we selected Taxol-resistant T98G cells by exposure to increasing concentrations of the drug (Supplementary Figure S5B) and then compared them with non-selected cells for responses to Bpep and Dpep. There was little difference in dose-responses for the peptides in resistant and non-resistant cultures, indicating that Bpep and Dpep were fully effective on Taxol-resistant tumor cells (Supplementary Figure S5B).
The lysosomal inhibitor chloroquine is currently in clinical trials for various cancers [43] and has been reported to enhance the release of cell-penetrating peptides from endosomes [44]. We therefore assessed combinations of chloroquine and Bpep/Dpep in a variety of cancer lines. The results ranged from near-additive (HCT116 cells, CI = 0.92 ± 0.08 for Bpep; 0.87 ± 0.07 for Dpep) to apparent synergy (T98G, CI = 0.56 ± 0.06 for Bpep; 0.75 ± 0.03 for Dpep; MDA-MB-231, CI = 0.59 ± 0.11 for Bpep; 0.47 ± 0.05 for Dpep) (Figure 3C; Supplementary Figure S5C).
The anthracycline doxorubicin is widely used to treat hematopoietic and solid tumors [45]. Combination studies in multiple lines also suggested near-additive effects of combinations of doxorubicin (50 nM) with Bpep and Dpep (Supplementary Figure S6A).
Due to its effects on chromatin structure and cell cycle, doxorubicin has been used to model cell senescence and cell cycle withdrawal [46,47], thus permitting us to ask whether Bpep/Dpep affects survival of non-proliferating cells. Accordingly, multiple lines were pre-treated with or without 100–200 nM doxorubicin for 24 h, then for 6 additional days with various Bpep/Dpep concentrations. Cell counts performed after pretreatment and at the end of study verified that doxorubicin-pretreated MDA-MB-231, A375 and HCT116 cells showed little replication, while T98G and MCF7 cells appeared to slow, but not entirely cease replication (Figure 3D; Supplementary Figure S6B). The anticipated effect of doxorubicin pretreatment on cell accumulation in G2/M was also verified in two lines (HCT116 and T98G) (Supplementary Figure S6C). Comparison of the dose-responses for control and doxorubicin-pretreated cultures revealed them to be essentially identical (Figure 3D; Supplementary Figure S6B). Together, these studies indicate that Bpep/Dpep act additively with doxorubicin to affect tumor cell growth/survival and that they diminish survival of tumor cells irrespective of the proliferative state.
3.4. Bpep and Dpep Suppress Expression of Direct CEBPB and CEBPD Targets IL6, IL8 and ASNS
If, as anticipated, Bpep and Dpep interfere with CEBPB and CEBPD function, they should affect expression of direct CEBPB/CEBPD targets. IL6 and IL8 have been identified as direct CEBPB and CEBPD targets [48,49], and there is evidence that cancer-cell-derived IL-6 and IL-8 promote tumor growth and metastasis and therapeutic resistance [50,51]. We therefore assessed IL6 and IL8 transcript levels in multiple cancer lines with or without 48 h of 20 µM Bpep or Dpep exposure. In each case, the peptides significantly reduced IL6 and IL8 expression (Figure 4A).
ASNS, the gene encoding asparagine synthetase, has been reported as a direct target of ATF5 and CEBPB [52,53], and its over-expression is associated with cancer cell proliferation, metastasis and therapeutic resistance [54]. Assessment of ASNS transcripts in the above lines also revealed significant down-regulation after 48 h of 20 µM Bpep or Dpep treatment (Figure 4B). Together, these findings indicate that Bpep/Dpep reduce expression of well-defined ATF5, CEBPB and CEBPD targets with cancer relevance.
3.5. Bpep and Dpep Deplete Anti-Apoptotic Protein Survivin and Reduce Expression of Direct ATF5 Targets BCL2 and MCL1
Survivin (encoded by the BIRC5 gene) is an anti-apoptotic protein often over-expressed in various cancer types and absent or little-expressed in normal cells [55]. Survivin depletion generally promotes tumor cell apoptotic death, and survivin is therefore recognized as an important therapeutic target [55,56,57]. We reported that dn-ATF5 depletes survivin in multiple tumor lines and that such depletion occurs prior to and is sufficient for their death [58]. We therefore assessed whether Bpep/Dpep would reduce survivin protein expression. Exposure of multiple lines to 20 µM Bpep or Dpep for 72 h promoted profound survivin depletion (Figure 5A).
We additionally examined the effects of the peptides on levels of survival proteins BCL2 and MCL1 in the same lines, which have been described as direct ATF5 targets [6,59]. BCL2 was significantly reduced in all cases (Figure 5A). MCL1 expression also showed significant, but variable, reduction, except in the case of HCT116 cells exposed to Dpep. (Figure 5A). Taken together, these findings identify survivin as a consistent and highly responsive pro-survival target of Bpep and Dpep with additional, more context-dependent effects on ATF5 targets BCL2 and MCL1.
3.6. BMF Is Upregulated by Bpep and Dpep and Is Required for Dpep-Promoted Cancer Cell Apoptosis
We next considered whether regulated pro-apoptotic proteins play roles in the apoptotic activities of Bpep/Dpep. A pilot RNAseq study with CP-dn-ATF5-treated T98G cells revealed that among pro-apoptotic genes, encoding BMF (BCL2-Modifying Factor) showed by far the largest elevation. To determine whether this was the case for Bpep and Dpep and occurred across multiple tumor cell types, we performed qPCR for BMF transcripts in multiple lines exposed to the peptides for 2 days. In all cases, there was a significant elevation of BMF expression (Figure 5B). To assess whether BMF plays a required role in Bpep/Dpep activity, we compared apoptosis levels in multiple cultures exposed to the control or two independent BMF siRNAs and then treated with or without Dpep. BMF knockdown was approximately 61–86% depending on the cell line (Supplementary Figure S7). In each case, BMF knockdown significantly suppressed Dpep-promoted apoptosis by approximately 44–67% (Figure 5C).
3.7. Bpep and Dpep Are Active In Vivo
We next assessed whether Bpep/Dpep have efficacy in living animals. Subcutaneous A375 melanoma xenografts were established in SCID mice which were then treated intraperitoneally with Bpep or Dpep (20 mg/kg) 3–4 × /week (Supplementary Figure S8A). There were no evident side effects over the 3-week treatment and no significant differences in weight of treated animals in comparison with vehicle-treated controls. Both peptides significantly reduced growth of the tumors with no major difference between their efficacy.
Because of the similar actions of Bpep and Dpep, subsequent experiments employed Dpep. To determine whether elevating Dpep dosing might increase anti-tumor activity, we compared effects of 20 and 50 mg/kg in mice bearing subcutaneously implanted B16-F10 murine melanoma cell tumors (Supplementary Figure S8B). While both doses significantly slowed tumor growth, there was no significant difference in their efficacy. There were also no evident side effects or differences in animal weight compared with controls over the 9-day treatment regimen for either dose. Next, using the A375 melanoma xenograft model, we asked whether Dpep (20 mg/kg) would affect survival in addition to tumor growth over a more extended treatment period (Figure 6A). As in our initial study, Dpep suppressed tumor growth up to 3 weeks of treatment (the time point when mice in the control group first reached the survival endpoint). With continued peptide dosing, there was a highly significant prolongation of survival time compared with controls. To assess efficacy in a second animal model, we employed subcutaneously implanted HCT116 cell xenografts (Figure 6B). Here also, despite more aggressive tumor growth, Dpep (20 mg/kg) significantly decreased tumor growth rate and prolonged survival time.
To verify that Dpep affects tumor cell survival in vivo as in vitro, we examined A375 xenograft tumors after two treatments with the peptide. H&E staining revealed widespread cell degeneration, while TUNEL staining indicated extensive apoptotic death compared with tumors from vehicle-treated animals (Figure 6C; Supplementary Figure S8C).
In addition, to monitor possible off-target actions of Dpep, we examined H&E-stained tissues from multiple organs (heart, lung, liver, kidney, spleen, brain, pancreas and intestine) of animals at the endpoint of the study shown in Figure 6A after a full course of treatment with the peptide or vehicle. In all cases, there were no discernable differences between the tissues from peptide- and vehicle-treated animals (see Supplementary Figure S9). Examination of heart, lung and liver sections from animals in the study described in Figure 6B also showed no differences between vehicle- and peptide-treated animals (data not shown).
4. Discussion
Numerous studies have associated ATF5, CEBPB and CEBPD with various aspects of malignancy, including patient prognosis and survival [1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33]. To target these transcription factors in a potentially clinically relevant way, we designed cell-penetrating dn peptides (Bpep and Dpep) to act as function-blocking decoys. The peptides promote apoptotic death of a wide range of tumor types, but not non-transformed cells; work additively or synergistically combined with other therapeutics; and, in animal models, inhibit tumor growth and increase survival without apparent side effects.
In past work, we characterized anti-tumor activity of a cell-penetrating dn-ATF5 [31,32]. A relevant question is why Bpep and Dpep may differ from CP-dn-ATF5 with respect to potential therapeutic value and merit further development. Firstly, as noted above, dn-ATF5 interacts with CEBPB and CEBPD in a leucine-zipper-dependent manner [33]. This strongly supports the idea that Bpep and Dpep conversely associate with ATF5. In contrast, dn-ATF5 does not associate with endogenous ATF5 [33]. Thus, while dn-ATF5 inhibits CEBPB and CEBPD function, Bpep and Dpep should inhibit not only CEBPB and CEBPD function, but also that of ATF5. This distinction is potentially important. ATF5 has been experimentally linked to cancer cell growth and survival, and its expression is associated with outcome in at least several cancers [2,3,4,5,6,12,13,15,18,22]. Furthermore, a novel DNA binding site for ATF5 has been identified [60], suggesting it regulates genes distinct from those that CEBPB and CEBPD regulate. In addition, ATF5 is characterized as an important player in the mitochondrial stress response, of relevance to tumor cell survival [61]. Moreover, in a non-transcriptional role, ATF5 has been reported as a critical component of the centrosome [62], also of relevance to cancer cell survival/growth. We are not aware of such roles for CEBPB or CEBPD. In addition, other cancer-relevant proteins are potentially bound and sequestered by Bpep and Dpep, but not by dn-ATF5. As an example, CEBPB forms functional heterodimers with ATF4, another transcription factor that protects cancer cells under stress conditions [63]. Further studies are warranted to better define the target differences between Dpep, Bpep and dn-ATF5. Finally, of importance, Dpep and Bpep show 5–10-fold greater potency compared with CP-dn-ATF5 [32].
Key features of Bpep and Dpep are the possession of the CEBPB and CEBPD leucine zipper sequence, respectively. Replacement of the heptad repeat leucines in these sequences eliminated or severely decreased anti-tumor cell activity, supporting the idea that Bpep/Dpep function via specific zipper–zipper interactions. Such dependence also reinforces the absence of non-specific toxicity by the peptides.
Although not identical, Bpep and Dpep show quite comparable activities. This includes similar efficacy and potency across multiple cell lines and in combination treatments, additive effects when tested in combination with one another and comparable in vivo efficacy. These findings suggest similar mechanisms of action. However, given that the peptides did not act identically in some situations, one cannot not rule out the possibility that there may be conditions or cancer types in which one peptide is significantly more effective than the other.
Bpep and Dpep show efficacy as monotherapies and in combinations with other cancer treatments. In each combination tested, the peptides did not interfere with partner activity and acted additively or synergistically. If, as appears, the peptides have little toxicity on their own, this supports the idea that they can be combined with therapeutics that have limiting side effects in order to achieve efficacy with partner doses below those causing toxicity.
An important concept in cancer therapeutics is that tumor cells may temporarily withdraw from the cell cycle, potentially for extended times, and thereby escape treatments that target rapidly dividing cells to seed metastasis and recurrence [64,65]. Here, we found that Bpep/Dpep inhibited survival of cancer cells rendered slowly- or non-replicating by pre-treatment with doxorubicin. This indicates that the peptides can cause death of tumor cells that are not actively in the cell cycle. Further studies will be needed to more fully define the range of tumor cell replication states that are susceptible to the peptides.
We found that Bpep and Dpep significantly reduced expression of known direct target genes of CEBPB (IL6, IL8, ASNS), CEBPD (IL6, IL8) and ATF5 (ASNS) as well as of proteins (BCL2 and MCL1) encoded by ATF5 target genes. While further studies will be required to verify that the peptides reduce association of the three transcription factors with their target genes, these findings support the idea that Bpep and Dpep interfere with the expression of genes regulated by CEBPB, CEBPD and ATF5. Beyond representing markers for Bpep and Dpep activity, IL6, IL8 and ASNS have potential relevance for cancer treatment. IL-6 and IL-8, derived either from tumors or their niche (which should also take up Bpep/Dpep), contribute to tumor growth, metastasis and therapeutic resistance [50,51]. ASNS over-expression is associated with aggressive tumor growth, while ASNS knockdown inhibits growth in certain tumor models [54]. Moreover, ATF5 gene polymorphisms that appear to enhance activity at the ASNS promoter are linked to asparaginase treatment resistance in childhood acute lymphoblastic leukemia [8]. These findings represent additional mechanisms that may contribute to the efficacy of Bpep and Dpep for cancer treatment, both by direct actions on tumor cells and their environment.
While we have yet to define the full set of molecular mechanisms by which Bpep and Dpep selectively kill tumor cells, our findings shed light on distal events leading to apoptosis. One is profound depletion of survivin, a member of the Inhibitor of Apoptosis (IAP) family with additional roles in cell proliferation and mitochondrial stress [55]. Survivin down-regulation is sufficient to interfere with cancer cell growth and survival in vitro and in vivo, and survivin is recognized as an attractive target for cancer treatment [55,56,57]. Another significant response is up-regulation of BMF, a pro-apoptotic member of the BCL2 family. Though BMF has received relatively less attention than other pro-apoptotic proteins in the context of cancer, an increasing amount of literature links its regulation to mechanisms of anti-cancer agents [66]. In addition to observing that the peptides significantly elevate BMF in multiple tumor lines, we found that BMF knockdown was sufficient to suppress their apoptotic activities. These findings thus indicate that Bpep and Dpep trigger apoptosis by setting in motion a set of molecular events that lead to survivin depletion and BMF activation.
The aim of this study was to evaluate the potentials of Bpep and Dpep as novel prototypic drugs for cancer treatment. Our in vitro studies verified their selective efficacy on a range of tumor cell types. We further observed efficacy in suppressing tumor growth in 3 different in vivo models, and in two survival studies, there was highly significant prolongation of survival time. We found that doses of 20 and 50 mg/kg had similar efficacy in suppressing tumor growth. It remains to be determined whether lower doses or a different treatment regimen would be equally or more effective. Even with prolonged treatments lasting more than 6 weeks, we did not observe loss of weight or other evident side effects in the animal subjects. Although more detailed studies will be required to fully examine in vivo safety of the peptides, the current findings point to a high degree of tolerability.
5. Conclusions
On the basis of the work described here, we conclude that the novel cell-penetrating peptides Bpep and Dpep promote apoptotic death of a wide range of cancer cells, both in vitro and in vivo without such effects on non-transformed cells. The distal part of the mechanism by which they do so includes depletion of the survival protein survivin and elevation of death protein BMF. Our findings support the idea that Bpep and Dpep or modified forms thereof have potential for treatment of a variety of cancer types. Our data also support their use in combination therapies in which they can augment the actions of other anti-cancer agents and/or reduce the levels needed to achieve efficacy.
Supplementary Materials
The following are available online at
Author Contributions
Conceptualization, J.M.A. and L.A.G.; formal analysis, Q.Z. and L.A.G.; investigation, Q.Z., X.S., N.P., P.J., T.T.T.N., M.D.S., J.M.A. and L.A.G.; writing—original draft preparation, L.A.G.; writing—review and editing, Q.Z., X.S., N.P., P.J., T.T.T.N., M.D.S., J.M.A. and L.A.G.; supervision, L.A.G.; project administration, L.A.G.; funding acquisition, M.D.S., J.M.A. and L.A.G. All authors have read and agreed to the published version of the manuscript.
Funding
This research was funded by the Thompson Family Foundation Initiative in Chemotherapy-Induced Peripheral Neuropathy (LAG); the Emerson Collective Cancer Research Fund (LAG); and National Institutes of Health grants 5R01NS072050 (LAG), 5R01NS083795-05 (JMA), R01NS095848 (MDS), R01NS102366 (MDS) and R01NS113793 (MDS). TTTN was supported by an American Brain Tumor Association Basic Research Fellowship in Memory of Katie Monson (BRF1900018). The Columbia Cancer Center flow core used in these studies was supported by National Institutes of Health grant P30CA013696.
Institutional Review Board Statement
The study was conducted according to the guidelines of the Declaration of Helsinki, approved by the Columbia University IACUC (protocol AC-AABE2555, approved 12 December 19) and followed guidelines set forth by the National Institutes of Health guide for care and use of laboratory animals.
Informed Consent Statement
Not applicable.
Data Availability Statement
The data presented in this study are available on request from the corresponding author.
Acknowledgments
We thank Kaitao Zhao for technical assistance with Western immunoblotting.
Conflicts of Interest
Lloyd A. Greene, Xiaotian Sun and James M. Angelastro are named as inventors on a patent application related to use of the peptides described here for treatment of cancer. The remaining authors declare no conflict of interest.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Figures
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). Notwithstanding the ProQuest Terms and Conditions, you may use this content in accordance with the terms of the License.
Abstract
Simple Summary
The gene-regulatory factors ATF5, CEBPB and CEBPD promote survival, growth, metastasis and treatment resistance of a range of cancer cell types. Presently, no drugs target all three at once. Here, with the aim of treating cancers, we designed novel cell-penetrating peptides that interact with and inactivate all three. The peptides Bpep and Dpep kill a range of cancer cell types in culture and in animals. In animals with tumors, they also significantly increase survival time. In contrast, they do not affect survival of non-cancer cells and have no apparent side effects in animals. The peptides work in combination with other anti-cancer treatments. Mechanism studies of how the peptides kill cancer cells indicate a decrease in survival proteins and increase in death proteins. These studies support the potential of Bpep and Dpep as novel, safe agents for the treatment of a variety of cancer types, both as mono- and combination therapies.
AbstractTranscription factors are key players underlying cancer formation, growth, survival, metastasis and treatment resistance, yet few drugs exist to directly target them. Here, we characterized the in vitro and in vivo anti-cancer efficacy of novel synthetic cell-penetrating peptides (Bpep and Dpep) designed to interfere with the formation of active leucine-zipper-based dimers by CEBPB and CEBPD, transcription factors implicated in multiple malignancies. Both peptides similarly promoted apoptosis of multiple tumor lines of varying origins, without such effects on non-transformed cells. Combined with other treatments (radiation, Taxol, chloroquine, doxorubicin), the peptides acted additively to synergistically and were fully active on Taxol-resistant cells. The peptides suppressed expression of known direct CEBPB/CEBPD targets IL6, IL8 and asparagine synthetase (ASNS), supporting their inhibition of transcriptional activation. Mechanisms by which the peptides trigger apoptosis included depletion of pro-survival survivin and a required elevation of pro-apoptotic BMF. Bpep and Dpep significantly slowed tumor growth in mouse models without evident side effects. Dpep significantly prolonged survival in xenograft models. These findings indicate the efficacy and potential of Bpep and Dpep as novel agents to treat a variety of cancers as mono- or combination therapies.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
Details
; Jefferson, Parvaneh 1 ; Nguyen, Trang T T 1
; Siegelin, Markus D 1 ; Angelastro, James M 2
; Greene, Lloyd A 1 1 Department of Pathology and Cell Biology, Vagelos College of Physicians and Surgeons, Columbia University, New York, NY 10032, USA;
2 Department of Molecular Biosciences, School of Veterinary Medicine, University of California Davis, Davis, CA 95616, USA;




