1. Introduction
Antimicrobial resistance is an escalating global health concern, with multiple infectious diseases becoming increasingly difficult and expensive to treat. An estimated 1.27 million deaths occurred in 2019 due to bacterial resistance to antibiotics [1], with the World Health Organization (WHO) stating that this number is expected to exceed 10 million by 2050 [2]. Antimicrobial resistance (AMR) develops through mutations in the bacterial genome as well as horizontal transfer of mobile genetic elements such as plasmids [3]. AMR is exacerbated by the routine administration of antibiotics both clinically and in agricultural settings [4]. Despite the steady increase in antibiotic resistant bacteria [5], there is a shortfall of novel antibiotics being developed, with no new classes approved for clinical use since the 1980s [6]. This gap between increasing antibiotic resistance and lagging discovery of new drug classes creates an urgent need for innovative therapeutic discovery methods to produce novel antimicrobials with different mechanisms of action to combat the emerging threat to public health [7].
Antimicrobial peptides (AMPs) are short, often cationic and amphipathic, biomolecules that are produced by the innate immune system of all living organisms [8]. They are a functionally and structurally diverse group of compounds that can defend against bacteria, viruses, fungi, and cancer [9]. AMPs can combat bacterial infections directly through interactions with the negatively charged membrane and with intracellular targets such as DNA and RNA [9,10]. In addition, AMPs can function indirectly through inflammatory or immunomodulatory pathways, resulting in the recruitment of immune cells [11]. Because of these diverse mechanisms of action, it has been suggested that it is more difficult for bacteria to develop resistance to AMPs as compared to conventional antibiotics [12,13]. However, bacteria intrinsically resistant to AMPs do exist [14], and resistance to colistin, an AMP-based therapeutic used as a last resort, has been observed [15]. Continuing the search for and characterization of AMPs with varying structure and associated mechanisms of action would increase our arsenal of available therapeutics against drug resistant bacteria.
The three-dimensional (3D) structures of AMPs can be classified into several types; α-helical, β-sheet containing, mixed, or linear extended structures [16]. It has been observed that many α-helical and linear extended peptides undergo conformational changes when interacting with the bacterial membrane [17]. The α-helix structure is reported to be the most effective conformation for AMPs to interact with the bacterial membrane, with size, sequence, charge and hydrophobicity all affecting the spectrum and level of the resulting antimicrobial activity [18]. However, the majority of discovered AMPs do not have a known structure, with approximately 25% of all entries in the Antimicrobial Peptide Database (APD3) reporting an experimentally determined structure [19]. Traditional methods for determining the structure of peptides, such as nuclear magnetic resonance (NMR), X-ray crystallography, and cryo-electron microscopy are laborious and expensive in comparison to in silico methods. While the latter only provide predictions, recent advances in artificial intelligence research bring the potential to make them enabling tools for characterizing AMPs. AlphaFold2 is a model that applies deep-learning to predict the 3D structure of proteins with high accuracy, including cases where there are no similar structures [20]. ColabFold has been reported to improve the speed of this prediction by coupling AlphaFold2 with an MMseqs2-based homology search [21].
Here, we studied the relationship between predicted AMP structure and observed antimicrobial activity. Specifically, we used ColabFold to predict the 3D structure of a list of 88 putative amphibian and insect AMPs discovered using rAMPage, a homology-based bioinformatic pipeline for in silico discovery of AMPs using RNA-seq reads [22]. We examined the antimicrobial activity of these peptides against two Gram-negative and one Gram-positive bacteria in the WHO’s list of priority pathogens [23]. We observe 51 AMPs in this list, discovered from 16 amphibian and 16 insect species, with antimicrobial activity and low toxicity to porcine erythrocytes and human embryonic kidney cells. Amphibians possess a diverse repertoire of AMPs, which provide a first line of defense as they transition from an aquatic to a terrestrial habitat throughout their life cycle [24]. Further, unlike vertebrates, insects lack an adaptive immune system, and as such their innate immune system, including AMPs, is their only line of defense in combating bacterial infections [25]. Studying these peptides, we report an association between AMPs with a predicted helical structure and broader antibacterial activity against the bacterial isolates of our panel.
2. Results
2.1. 3D Structure Prediction and Clustering
A total of 1137 putative AMPs were identified by rAMPage, and 88 peptides were selected for synthesis using three selection criteria: “Species Count”, “Insect Peptide”, or “AMPlify Score” (see Methods). The shortlist of 88 putative AMPs include 21 peptides described previously [22]. We investigated, in three independent experiments per peptide, the antimicrobial activity of the 88 peptides against Escherichia coli ATCC 25922, a clinical strain of Salmonella enterica serovar Enteritidis, and Staphylococcus aureus ATCC 29213. Fifty-one peptides showed antimicrobial activity against at least one of these bacterial strains (Table 1). To investigate the relationship between estimated structure and bioactivity, we predicted the 3D structures of the 88 mature peptides using ColabFold [21]. These were clustered based on their structural similarities evaluated by TM-score, and STRIDE [26] was used to assign the secondary structure of these predictions. The bioactivity of the peptides was classified as high when the median minimum inhibitory concentration (MIC) was ≤4 μg/mL, moderate when 4 < median MIC ≤ 16 μg/mL, and low when 16 < median MIC ≤ 128 μg/mL. As the highest concentration of peptide tested was 128 μg/mL, a median MIC of >128 μg/mL was classified as ‘no inhibition observed’ (N/O). Approximately half (45/88) of the peptides were predicted to adopt a helical structure, three adopted a structure containing β-strands, 17 adopted a linear extended structure, and 23 peptides were predicted to contain both helical and linear extended regions (Figure 1). The latter 23 peptides were classified as either mainly extended (>50% residues fell in extended category; six peptides) or mainly helical (between 50–80% residues in helical structures; 17 peptides). All structural categories contained both amphibian- and insect-derived peptides of varying length, charge, and hydrophobicity profiles. There was an association between antimicrobial activity and structure, with 8% of active peptides being linear extended and 71% being helical, despite extended peptides accounting for 19% of total peptides and helical only accounting for 51%. This association was statistically significant at the alpha = 0.05 level, with a p-value = 6.6 × 10−5. Predicted helical/extended content did not correlate with observed in vitro antimicrobial activity when the percentage of helical residues was less than 80%. Approximately half of the mainly helical and mainly extended peptides were active.
2.2. Antimicrobial Susceptibility Testing and Cytotoxicity
We tested the 88 putative AMPs for their antimicrobial activity using a broth microdilution assay [27,28]. The panel of bacteria tested included two Gram-negative strains: E. coli ATCC 25922 and Salmonella Enteritidis. Additionally, we tested one Gram-positive strain: S. aureus ATCC 29213. Of the 88 peptides tested, 51 displayed antimicrobial activity (MIC ≤ 128 µg/mL) against at least one of the pathogens, including 35 from amphibian and 16 from insect sources (Figure 2A). All AMPs that only inhibited growth of E. coli (10 peptides) had low activity. Eleven peptides were selective against the Gram-negative bacteria, with no inhibitory activity against S. aureus at the tested concentrations. Further, 30 peptides were active against both Gram-negative and Gram-positive species, with 5 having no inhibitory effect on Salmonella Enteritidis and 25 being active against all three species. Bioactivity quantitative data is displayed in Table S1 (Supplementary Materials). Additionally, the hemolytic 50 concentration (HC50, see Methods for definition) of the peptides was determined with porcine red blood cells as a cost-effective initial toxicity assessment of the AMPs. Six of the active peptides displayed low hemolytic activity, with the HC50s ranging from 64–128 µg/mL.
A total of 14 peptides displayed high antimicrobial activity against at least one of the pathogens tested. The three most active amphibian peptides, OdMa2, PeNi1 and PeNi9, were broadly active. OdMa2 and PeNi1 had MICs of 4 µg/mL against E. coli and 8–16 µg/mL against Salmonella Enteritidis. OdMa2 had an MIC of 4–8 µg/mL and PeNi1 had an MIC of 4 µg/mL against S. aureus. PeNi9 had MICs of 2–4 µg/mL against E. coli, 8–16 µg/mL against Salmonella Enteritidis, and 4–8 µg/mL against S. aureus. OdMa2 was slightly hemolytic, having an HC50 = 128 µg/mL, while PeNi1 and PeNi9 did not show hemolytic activity at the highest concentration tested. The three most active insect peptides were PaVa1, TeBi1 and TeRu4. PaVa1 and TeRu4 were selectively active against Gram-negatives, with MICs of 2–4 µg/mL and 1 µg/mL against E. coli and 4–8 µg/mL and 2–4 µg/mL against Salmonella Enteritidis, respectively. These two peptides did not inhibit growth of S. aureus at the concentrations tested. TeBi1 was broadly active, with an MIC of 1–2 µg/mL against E. coli, 4–8 µg/mL against Salmonella Enteritidis and S. aureus. All top three insect peptides were not hemolytic at the concentrations tested.
The six most active peptides were tested for cytotoxicity against the human embryonic kidney cell line HEK293 using the alamarBlue cell viability assay. PeNi1 and OdMa2 were toxic to less than 10% of cells up until 32 µg/mL, where cell viability decreased to <75% at 64 µg/mL and to approximately 0% at 128 µg/mL (Figure 2B). More variation in cell viability was observed at 64 µg/mL for these peptides compared to other concentrations. Cell viability when exposed to PeNi9 and TeBi1 was, on average, 0% and 40% at 128 µg/mL, respectively. These peptides had low or no cytotoxicity at lower concentrations. We observed that TeRu4 and PaVa1 were not toxic to HEK293 cells at any of the concentrations tested.
2.3. Sequence and Structural Characterization of AMPs Discovered Using rAMPage
To investigate the sequence diversity of the 51 peptides displaying antimicrobial activity, we performed a multiple sequence alignment of the mature amino acid sequences and generated a phylogenetic tree. Peptides derived from amphibian/insect datasets mostly clustered with other peptides from the same datasets (Figure 3A). To investigate whether the mature sequences were similar to any known proteins, we performed a local BLASTp [29] search of the validated AMPs. Approximately two thirds of the peptides were novel, with less than 100% sequence identity to their top BLAST hits (Figure 3A). Of these peptides, six amphibian-derived and seven insect-derived AMPs had no significant hits in the non-redundant protein database. CaCa1 and CaCa2 had 100% sequence identity with their top BLAST hits but no antimicrobial activity was indicated in the NCBI entries. OdMa13, PeNi11, OdMa5, OdMa6, OdMa7 and RaCa15 were identical to AMPs seen in other organisms of the same genera (Table S2). OdMa10, an AMP discovered in the frog Odorrana margaretae, was identical to the AMP nigrosin-MG1 from this species. PeNi8, PeNi10, and PeNi7, derived from the black-spotted frog Pelophylax nigromaculatus, aligned with 100% sequence identity to the mature region of the AMPs pelophylaxin-2, ranatuerin-2N, and nigrocin-6N, respectively, from this species. Of note, we also discovered the mature sequence of PeNi8 in five other amphibian species, PeNi10 in four other amphibian species, and PeNi7 in six other amphibian species. TeBi1, PeNi3 and RaOm3 also had BLAST hits with 100% sequence identity to precursors of known antimicrobial peptides, however they were not identical to the mature bioactive peptide. TeBi1 included the sequence of the mature AMP bicarinalin from the same species, but at its C-terminus it also contained three amino acids present in the peptide precursor but not in the mature sequence. Of their top BLAST hit esculentin-2N, a 36-residue AMP, PeNi3 and RaOm3 only spanned 18 and 19 residues, respectively. Additionally, PaVa1 had 100% sequence identity to a region of an apidaecin type 14-like isoform; however no mature region was annotated in this result and no in vitro validation of antimicrobial activity was available from public repositories.
Further, we analyzed our peptide sequences with InterProScan to identify protein family domains and classifications. We discovered 18 active amphibian peptides containing the signature for the Ranidae AMP Nigrocin-2 family, three from the Brevinin-1 family, and seven with the Brevinin-2 signature. Additionally, we classified two insect peptides as being a part the Apidaecin family. While PaVa1 was not identified as containing any family signatures by InterProScan, we classified it as an Apidaecin as it possessed the RP… PRPPHPRL motif that has been identified as being conserved in Apidaecins [30]. Most Nigrocin-2-like peptides (15/18) were 21 amino acids long (Figure 3B) with all 21 residues identified as part of the family signature. OdMa4, which is 14 amino acids long, aligns with the N-terminal of the other 15 peptides and 100% of its length is identified as containing the signature. In contrast, the two peptides longer than 21 amino acids, OdTo4 and PeNi5, only have part of their sequences containing the signature. The peptides characterized as belonging to the Brevinin-1 family were longer and contained more hydrophobic residues than most of the Nigrocin-2 peptides within our set (Figure 3C). All peptides classified as being part of the Brevinin-2 family (Figure 3D) were longer than those in the Nigrocin-2 and Brevinin-1 families, containing 29–30 amino acids and 1–2 negatively charged residues.
To explore the relationship between predicted helical or extended structure and activity, we investigated the distribution of bioactive peptides for each bacterial species tested in relation to the percentage of residues contained in helical or extended structures. Peptides with higher extended content were active against E. coli and Salmonella Enteritidis, but not S. aureus (Figure 4). All peptides with activity against S. aureus were predicted to have some helical secondary structure, with the majority having >70% of the peptide assigned as having helical structure. Peptides identified as containing the signatures for the Apidaecin, Nigrocin-2, Brevinin-1 and Brevinin-2 families appeared to possess similar bioactivity profiles and predicted secondary structure content to other members within their families. Superimposed predicted structures for the family members can be found in Figure S1. The two Apidaecin peptides were linear extended and selective to the Gram-negative bacteria tested, with moderate to high activity against both E. coli and Salmonella Enteritidis. The Brevinin-2 and Nigrocin-2 peptides were mostly helical and broadly active against all three bacteria with the exception of OdMa4, which is mainly extended and displayed selective antimicrobial activity against the Gram-negative bacteria tested. All of the Brevinin-1 peptides were mostly helical and active against E. coli, non-inhibitory against Salmonella Enteritidis, and two out of three were active against S. aureus.
3. Discussion
In the present study, we characterized 51 AMP candidates originally derived from a bioinformatics scan of RNA-seq data from amphibians and insects using rAMPage [22]. Fourteen of these had high antimicrobial activity to at least one of the bacterial species tested. The most bioactive amphibian AMPs, PeNi1, OdMa2 and PeNi9, and the insect peptide TeBi1 were active against all three bacteria. TeRu4 and PaVa1 both demonstrated selectivity for the Gram-negative species tested, with TeRu4 having higher antimicrobial activity against both strains.
The AMPs reported herein had low to no toxicity, with only six peptides having hemolytic activity at the highest concentrations tested. This observation is consistent with previous research that suggests that AMPs tend to have selectivity for microbial cells over eukaryotic cells due to differences in membrane composition [31]. Despite this selectivity, some AMPs do disrupt mammalian membranes and cell processes [32]. In the reported list of AMPs, PeNi1, OdMa2, PeNi9 and TeBi1 only displayed high levels of cytotoxicity at concentrations higher than their MICs. The ratio of the toxicity to the MIC of the peptides is described using the selectivity index, with a larger selectivity index indicating preference for bacterial cells [33,34] (Table S3). TeBi1 displayed the most selectivity of these, as it was not toxic to over 50% of cells until 16 to 128-fold its MIC. TeRu4 and PaVa1 were not toxic against either porcine erythrocytes or HEK293 cells. The selectivity indices of TeBi1, TeRu4 and PaVa1 make them good candidates for therapeutic development.
The AMPs characterized here vary in their amino acid sequences, with 30 active peptides belonging to four AMP families. AMPs from the Ranidae family can be classified into 14 peptide families based on their amino acid sequence, with AMPs from the same peptide family thought to share a common evolutionary origin [35]. We identified AMPs from three of these families: Brevinin-1, Brevinin-2 and Nigrocin-2 using the families’ signatures. Brevinin-2 peptides are the longest of the three, with a mature peptide length of 33–34 residues [36]. Brevinin-1 and Nigrocin-2 peptides are shorter, with an approximate length of 24 and 21 amino acids, respectively [36]. However, there is considerable variation among individual family members [36]. AMPs from these three families share some common characteristics: presence of a C-terminal disulfide-bridged cyclic heptapeptide, otherwise known as the ‘Rana box’, and antimicrobial activity against both Gram-negative and Gram-positive bacteria [36,37]. Additionally, Brevinin-1, Brevinin-2 and Nigrocin-2 peptides have been found to adopt an amphipathic α-helical conformation in membrane-like environments [36,37,38]. All peptides we identified as members of these families included the Rana box and were predicted to have a helical or mainly helical structure except for the Nigrocin-2 peptide OdMa4. OdMa4 was the shortest of the Nigrocin-2 peptides and terminated after the first cysteine of the Rana box. Additionally, we identified two peptides belonging to the Apidaecin AMP family. Apidaecins are short, proline-rich AMPs produced by insects [30]. These peptides do not typically form α-helices or β-strands [30], as was seen with ApCe1 and PaVa1, which were predicted to have linear extended structures. Similar to other Apidaecins, both ApCe1 and PaVa1 showed antimicrobial activity against Gram-negative bacterial species but not Gram-positives [30].
Most of the validated AMPs were predicted to adopt a helical structure by ColabFold, despite helical structures only making up half of the peptide set. In contrast, predicted linear extended peptides made up a smaller proportion of the antimicrobially active peptides compared to their abundance in the overall set. Note that, while there was a tendency of peptides with a predicted helical structure to be bioactive, not all of the helical peptides were active, and vice versa. In addition, we observed that while there were peptides from all structural categories that were active against Gram-negative species, only peptides that had some predicted helical content were active against both Gram-positive and Gram-negative bacteria. AMPs that form α-helices make up the majority of AMPs with known structure, and it is thought to be the most effective structure rendering antibacterial activity against the bacterial membrane [18]. However, this also biases machine learning algorithms such as the one we used to discover the tested peptides in favour of peptides with α-helix structures.
The majority of known AMPs do not have an experimentally validated structure [19]. Determination of peptide structures is often accomplished with NMR, X-ray crystallography or cryo-EM; however, this is time consuming and costly in comparison to in silico techniques. In contrast, one can predict the secondary and tertiary structures in a high-throughput manner based on the amino acid sequences of peptides of interest using a tool like ColabFold [21] prior to synthesis and testing. The association between ColabFold predicted structures and antimicrobial activity identified here can be informative in selecting peptides identified in silico as putative AMPs for in vitro validation. Further, AMPs are often chemically modified to improve their stability and bioavailability. The insights into the predicted structure-function relationships identified here could also be used to investigate how chemical modifications may influence antimicrobial activity.
One of the limitations of using rAMPage for peptide discovery is that the pipeline uses RNA-seq reads, and thus does not detect post-translational modifications such as amidation. Amidation of the C-terminus is a common post-translational modification of AMPs [39], and can impact the antimicrobial activity and toxicity of peptides [40]. PeNi12 for example, has 100% sequence identity to the mature region of ranacyclin-N from P. nigromaculatus, however PeNi12 was non-inhibitory against our panel of bacteria at all concentrations tested. Ranacyclins have amidated C-termini [41], so the non-amidated carboxyl end may have contributed to the lack of antimicrobial activity of PeNi12. TeBi1 has 100% sequence identity to the C-terminus region of the propeptide of bicarinalin and includes the mature sequence of bicarinalin, however the last three amino acids at the C-terminus of bicarinalin precursor are cleaved off and the peptide is amidated [42]. Additionally, as the peptides were only tested in vitro, we cannot conclude that the peptides that did not exhibit antimicrobial activity are not AMPs as they may have immunomodulatory properties or act on other bacterial strains not tested in the present study. The AMPs identified here may be tested in vivo to determine if they interact with the immune system to combat infections within the host.
While ColabFold determines protein structures in silico with high accuracy, peptides in their biological environments are flexible and may adopt different conformations [17]. AMPs that adopt a helical structure at the membrane are often disordered in aqueous environments [17]. Thus, the predicted structure may not be representative of the 3D structure of the peptide when interacting with specific targets. Additionally, AMPs have diverse sequences and targets. Peptides that act on the bacterial membrane may have different structural characteristics compared to those that mainly interact with intracellular components. Future investigations into the mechanism of action of these AMPs would shed light into how the predicted secondary structure impacts their biological function. The bioinformatic characterization of these AMPs is a cost-effective initial step in studying their mechanisms of action.
AMPs are a promising alternative to conventional small molecule antibiotics as they represent a diverse group of molecules with a wide variety of physiochemical properties. Here, we present the discovery and characterization of structurally and functionally diverse AMPs with potent antimicrobial activity and low toxicity. We also demonstrate the utility of predicting the structure of AMPs and report a significant association between peptides predicted to adopt a helical conformation and observed antimicrobial activity (p = 6.6 × 10−5). The potential of structural prediction to prioritize putative AMPs is an exciting avenue for discovery of new therapeutics in our fight against bacterial infections.
4. Materials and Methods
4.1. Peptide Discovery Using rAMPage
Peptide sequences were discovered using the Rapid Antimicrobial Peptide Annotation and Gene Estimation (rAMPage) pipeline v1.0 [22], which is publicly available on Github (
The putative AMPs were filtered to retain peptides with a minimum charge of +2 and maximum length of 30 amino acids. Peptides were further characterized with ENTAP v0.10.7 [49], Exonerate v2.4.0 [50] and SABLE v4.0 [51] before being clustered with CD-HIT v4.8.1 [52]. Ninety sequences were prioritized for synthesis from this list using three selection criteria:
“Species Count”—peptides identified in two or more species;
“Insect Peptide,”—insect-derived peptides chosen using a reduced AMPlify prediction score threshold; and
“AMPlify Score”—the top-scoring peptides with the highest net positive charge.
Peptides were purchased from GenScript and provided in lyophilized 0.08 milligram aliquots. Two peptides were unable to be synthesized, resulting in a final experimental set of 88 putative AMPs.
4.2. Bacterial Isolates
Bacteria were grown overnight at 37 °C in Mueller-Hinton Broth (MHB; Sigma-Aldrich, St. Louis. MO, USA) in a shaking incubator and aliquoted into cryovials with a 50% glycerol solution in a 1:1 ratio. No additives were added to the MHB during the growth of bacterial isolates. Glycerol stocks were stored at −80˚C.
4.3. Antimicrobial Susceptibility Testing (AST)
The antimicrobial activity of the putative AMPs was determined by a broth microdilution assay as described by the Clinical and Laboratory Standards Institute [27], with the published adaptations for testing of cationic peptides [28]. Escherichia coli 25922 and Staphylococcus aureus 29213 isolates were purchased from the American Type Culture Collection (ATCC; Manassas, VA, USA). A human clinical isolate of Salmonella enterica serovar Enteritidis was provided by the BC Centre for Disease Control. Bacteria from stocks stored at −80 °C were streaked onto nonselective Columbia blood agar with 5% sheep blood (Oxoid) and incubated overnight at 37 °C. Next, 2–4 colonies were streaked onto a new agar plate to ensure uniform health of colonies used in the broth microdilution assay. Isolated colonies were suspended in MHB and the optical density was measured with a spectrophotometer to create an initial inoculum concentration of approximately 1 × 108 cfu/mL. The inoculum was diluted 1:250 to a final concentration of 2–8 × 105 cfu/mL, which was confirmed by performing a Total Viability Count (TVC). The TVC consisted of plating a 1:1000 dilution of the final inoculum on nonselective media and was also used to confirm the health and purity of the inoculum in each trial.
Lyophilized 80 µg peptide aliquots synthesized by GenScript (Piscataway, NJ, USA) were resuspended to 1.28 mg/mL with UltraPure water (Thermo Fisher Scientific, Waltham, MA, USA) and serially diluted in polypropylene 96-well microtiter plates (Greiner Bio-One #650261, Kremsmünster, Austria) from 128 down to 0.5 µg/mL. Two columns per plate were reserved for growth and sterility controls. Inoculum was added to the wells containing the peptide and the growth control. Plates were incubated for 20–24 h at 37 °C. The minimum inhibitory concentration (MIC) was determined as the lowest peptide concentration where there was no visible bacterial growth.
4.4. Structure Prediction and Clustering
We predicted the 3D structures of the mature peptides using a local installation of ColabFold [21]. Using ColabFold’s server, five structures were generated for each peptide with sub-models of AlphaFold. Structural templates were used as input along with the peptide sequences for better accuracy. The five estimated structures were relaxed using the Amber force field, which helps remove stereochemical violations in predictions [20]. The five structures for each sequence were ranked by the per-residue estimate of AlphaFold’s confidence in its prediction (pLDDT score). The PDB file of the Amber relaxed rank 1 model for each peptide was used for further analysis.
Similarity of the predicted structures of peptides was determined using mTM-align (version 20180725) [53], which was used to prepare a distance matrix calculated from the pairwise TM-scores of the PDB files produced for each peptide. This distance matrix was clustered using scipy.cluster.hierarchy [54] in python with complete linkage to produce a dendrogram. PDB files were fed into STRIDE [26] and the residue assignments were used to categorize peptides. Peptides were classified into linear extended peptides (only possessing turn secondary structure and/or coils), mainly extended (>50% of the residues were in the extended category), mainly helical (between 50–80% of the residues were helical), helical (>80% of the residues were assigned as participating in an α-, pi- or 310-helical structure), or β-strand containing. The fisher.test() function in base R was used to conduct a Fisher’s exact test to investigate the independence of the helical or linear extended structure and possession of activity. Only peptides classified as helical (≥80% of residues assigned helical, 45 peptides) or linear extended (no residues in helical or β-strand structures, 17 peptides) were included in this statistical test. Peptides were labeled as active if they visually inhibited at least one of the bacterial strains at one of the tested concentrations.
4.5. Hemolysis Assay
Peptides were evaluated for toxicity using three independent hemolysis experiments. Whole blood from healthy donor pigs, supplemented with Na Citrate, was purchased from Lampire Biological Laboratories (Pipersville, PA, USA). Red blood cells (RBCs) were washed and isolated by three centrifugation cycles using Roswell Park Memorial Institute medium (RPMI; Thermo-Fisher Scientific) to create a 1% (v/v) RBC solution. Lyophilized AMPs were suspended and serially diluted from 128 down to 1 μg/mL using RPMI in a 96-well plate, before being combined with 100 μL of the 1% RBC solution. Following a minimum 30 min incubation at 37 °C, plates were centrifuged and ½ volume from each supernatant was transferred to a new 96-well plate. The absorbance of these wells was measured at 415 nm. To quantify hemolytic activity and determine the AMP concentration that lyses 50% of the RBCs (HC50), absorbance reading from wells containing RBCs treated with 11 μL of a 2% TritonX-100 detergent solution (TX-100) or RPMI (AMP solvent-only) were used to define 100% and 0% hemolysis, respectively. All centrifugation steps were performed at 500× g for five minutes in an Allegra-6R centrifuge (Beckman Coulter, Brea, CA, USA).
4.6. Cytotoxicity
The human embryonic kidney cell line HEK293 and the corresponding growth media and supplements were purchased from the ATCC. The cells were maintained in Eagle’s Minimum Essential Medium (EMEM) supplemented with 10% fetal bovine serum (FBS) and 1% Penicillin-Streptomycin solution and grown in a 5% CO2 incubator at 37 °C. Approximately 1 × 104 cells were distributed to each well of a 96-well flat-bottom cell culture plate (Corning #3595, Corning, NY, USA). Cells were incubated overnight to allow them to adhere. Lyophilized 80 µg peptide aliquots were resuspended to 1.28 mg/mL with UltraPure deionized water and serially diluted in polypropylene 96-well microtiter plates from 128-0.5 µg/mL. TX-100 was diluted to 2% in UltraPure deionized water and added as a positive control. Complete growth medium was added to the peptides and TX-100 containing wells. Spent growth medium of wells with adhered cells was replaced with the contents of wells containing serially diluted peptides or TX-100. Cells were incubated for four hours at 37 °C in 5% CO2 incubator. Growth medium containing peptides or TX-100 was replaced with fresh growth medium containing 10% (v/v) alamarBlue (Bio-Rad Laboratories, Hercules, CA, USA) and incubated for 20 h. Fluorescence was measured at excitation of 540 nm and emission of 590 nm in a Cytation 5 plate reader (Agilent BioTek, Winooski, VT, USA) and results recorded and analyzed with Gen5 software (Agilent BioTek, Winooski, VT, USA). The average fluorescence reads of TX-100 and growth media only wells were used to calculate 0% and 100% cell viability, respectively. The percentage of viable cells at each peptide concentration was determined by:
4.7. BLAST and Phylogenetic Analysis
Amino acid sequences for the mature peptides tested in vitro were used as the query sequences for BLASTp analysis with NCBI BLAST+ v2.13.0 [29]. The sequences were searched against the non-redundant protein database (downloaded on 01/19/2022) [29]. Max target sequences was set to 5. To identify protein family memberships, mature sequences were fed into InterProScan v5.56-89.0 [55] in FASTA format with default parameters. Multiple sequence alignment was performed with the 51 validated AMPs using the Bioconductor R package msa v1.28.0 [56] with the ClustalW option. A distance matrix was created using the multiple sequence alignment with the seqinr package v5.6-2 [57] and a phylogenetic tree using neighbour-joining tree estimation was created using the ggtree v3.4.2 [58,59,60,61] and ape v5.6-2 [62] R packages. AMP protein families, origin of AMPs and BLASTp results were annotated on the phylogenetic tree using ggtree [58,59,60,61].
Conceptualization, D.S., C.C.H., F.H., L.M.N.H. and I.B.; Data curation, C.L. and D.L.; Project administration, M.K.; Funding acquisition, C.C.H., F.H., L.M.N.H. and I.B.; Methodology, D.S., L.C., D.L., R.L.W., F.H., L.M.N.H. and I.B.; Software, H.E., C.L. and D.L.; Validation, A.R., D.S., A.B., N.L. and A.Y.; Writing—original draft, A.R. and D.S.; Writing—review and editing, C.L., L.C., D.L., R.L.W., A.Y., C.C.H., F.H. and I.B. All authors have read and agreed to the published version of the manuscript.
Not applicable.
Not applicable.
Characterization results of AMPs with respect to known AMPs, MIC ranges of all tested peptides and selectivity index ranges of bioactive AMPs against the tested bacteria can be found in the
I.B. is the founder of, and a shareholder in, Amphoraxe Life Sciences Inc., Vancouver, BC, Canada.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Figure 1. Agglomerative hierarchical clustering of peptides based on their predicted 3D structures. The bioactivity of each peptide against the three organisms tested (E. coli ATCC 25922, Salmonella Enteritidis, and S. aureus ATCC 29213) is reported in the top three rows. Bioactivity is assigned based on the median MIC and categorized as high for peptides with a MIC ≤ 4 µg/mL, moderate for 4 < MIC ≤ 16 µg/mL and low for 16 < MIC ≤ 128 µg/mL. Peptides that did not inhibit bacterial growth at tested concentrations were classified as ‘no inhibition observed’ (N/O). Physiochemical attributes of the AMPs tested (length, charge, and hydrophobicity) are displayed in rows 4, 5 and 6 using purple, pink and green gradients, respectively. The colour-coded peptide secondary structures (helical, mainly helical, mainly extended, linear extended and β-strand containing) shown in row 7 were assigned based on 3D coordinates of predicted structures. AMP name labels below the dendogram are colour-coded to indicate their amphibian (green) or insect (brown) origin.
Figure 2. Antimicrobial activity and mammalian cell toxicity of peptides discovered. (A) Minimum inhibitory and hemolytic 50 concentration (MIC and HC50, respectively) of peptides with antimicrobial activity against at least one bacterial strain within a panel composed of E. coli ATCC 25922, Salmonella Enteritidis and S. aureus ATCC 29213. HC50 was determined using porcine red blood cells (RBCs), as described in the Methods. Bioactive peptides identified from amphibian (green text) and insect (brown text) datasets are shown. Peptide bioactivity levels are separated by grey shaded blocks. From top to bottom, the dark grey block indicates no observable activity, the medium-dark grey block includes low activity, the medium grey block designates moderate activity, and the light grey block corresponds to high antimicrobial activity. (B) Mean relative cellular viability of HEK293 (cultured human kidney cells) after 24 h incubation with the six most active insect and amphibian peptides at concentrations up to 128 µg/mL from three independent experiments. Error bars indicate range of data.
Figure 3. Phylogenetic analysis of validated AMPs. (A) Circular phylogenetic tree based on a multiple sequence alignment of active rAMPage peptides with family classifications highlighted (colour-coded AMP names). The origin of AMP (insects in brown and amphibian in green) and BLASTp percent identity to entries in the NCBI non-redundant protein database (on a scale of 0–100%) are indicated by the inner and outer rings, respectively. Tip points of peptides that do not have 100% sequence identity to the bioactive region of known AMPs are highlighted in red. Multiple sequence alignments of the Nigrocin-2 (B), Brevinin-1 (C) and Brevinin-2 families (D), with the outlines indicating the identified family signature.
Figure 4. Predicted structural content and antimicrobial activity of 51 bioactive peptides against E. coli, Salmonella Enteritidis, and S. aureus. Secondary structure content indicated by the percentage of residues assigned to participate in helical vs. linear extended regions. Distribution of AMP family members and level of antimicrobial activity are distinguished by colour and size of circles, respectively.
Sequences and physiochemical properties of the 51 bioactive AMPs discovered using rAMPage.
| Peptide Name | Source Organism | Sequence | Length | Charge * | AMPlify Score | MW (Da) |
|---|---|---|---|---|---|---|
| AmMa1 | Amolops mantzorum | GILDTLKQLGKAAVQGLLSKAACKLAKTC | 29 | 4 | 80.0 | 2943.59 |
| AnFl2 | Anterhynchium flavomarginatum | GILRSLGWIQMPRSRRRHR | 19 | 6 | 31.8 | 2375.82 |
| ApCe1 | Apis cerana | GIYTGRLLPVYIPQPRPPHPRLRR | 24 | 5 | 38.6 | 2853.39 |
| BoAr6 | Bombus ardens | GILRLVTRRFRFSPTNLNRYTVARLVSGVP | 30 | 6 | 22.1 | 3460.06 |
| BoUs1 | Bombus ussurensis | RKIIAVSVHKLCRVKR | 16 | 6 | 29.9 | 1906.40 |
| CaCa1 | Camponotus castaneus, Odontomachus monticola, |
FACPIGFFRLKR | 12 | 3 | 7.27 | 1454.79 |
| CaCa2 | Camponotus castaneus, Odontomachus monticola, |
FIKTQVLKHLVAGVRVARGLDWKWR | 25 | 5 | 28.7 | 2977.57 |
| CaCa4 | Camponotus castaneus | RRFFFATAPCGYSRKFCKITRRKR | 24 | 9 | 23.6 | 2996.58 |
| DiLo | Diachasmimorpha longicaudata | GAFVLWGPTPRPRRR | 15 | 4 | 26.0 | 1766.07 |
| LiVe1 | Litoria verreauxii | GWLDIAKKVASVVAGIVKR | 19 | 3 | 80.0 | 2010.44 |
| LiVe2 | Litoria verreauxii | GWLDIAKKVASVVAGLGKR | 19 | 3 | 70.0 | 1968.36 |
| MyGu1 | Myrmecia gulosa | RRAIFASIRGYLGLRKR | 17 | 6 | 25.3 | 2033.44 |
| NaVi3 | Nasonia vitripennis x Nasonia giraulti F1 | KLFLTLWKLKR | 11 | 4 | 30.5 | 1445.84 |
| OdMa1 | Odorrana margaretae | GLLSGILGAGKKIVCGFSGLC | 21 | 2 | 80.0 | 1993.45 |
| OdMa2 | Odorrana margaretae | GLLRGILGAGKKIVCGLSGLC | 21 | 3 | 67.0 | 2028.54 |
| OdMa3 | Odorrana margaretae | GLLSGLLGAGKKIVCGLSGMC | 21 | 2 | 80.0 | 1977.47 |
| OdMa4 | Odorrana margaretae | GILSGLLGAGKKIVC | 15 | 2 | 70.0 | 1428.79 |
| OdMa5 | Odorrana margaretae | GILSGLLGAGKKIVCGLSGLC | 21 | 2 | 80.0 | 1959.43 |
| OdMa6 | Odorrana margaretae | GLLSGVLGVGKKIVCGLSGLC | 21 | 2 | 80.0 | 1973.46 |
| OdMa7 | Odorrana margaretae | GLLSGVLGVGKKVLCGLSGLC | 21 | 2 | 80.0 | 1973.46 |
| OdMa9 | Odorrana margaretae | GLISGILGAGKKVLC | 15 | 2 | 67.0 | 1428.79 |
| OdMa10 | Odorrana margaretae | GLISGILGAGKKVLCGLSGLC | 21 | 2 | 70.0 | 1959.43 |
| OdMa12 | Odorrana margaretae | GFMDTAKNVAKNVAVTLLYNLKCKITKAC | 29 | 4 | 70.0 | 3158.82 |
| OdMa13 | Odorrana margaretae | GFMDTAKNVAKNVAVTLLDNLKCKITKAC | 29 | 3 | 67.0 | 3110.73 |
| OdTo1 | Odorrana tormota | GILSGLLGAGKKLACGLIGLC | 21 | 2 | 80.0 | 1957.46 |
| OdTo2 | Odorrana tormota | GIFGGHLKVGKKIACGLSGLC | 21 | 3 | 67.0 | 2058.52 |
| OdTo3 | Odorrana tormota | GIFGGLLKEGKKIACGLSGLC | 21 | 2 | 48.5 | 2064.53 |
| OdTo4 | Odorrana tormota | KLMIPRKKRGIFGGLLKVGKKIACGLSGLC | 30 | 8 | 47.4 | 3186.06 |
| PaVa1 | Partula varia | RPRPQQVPPRPPHPRLRR | 18 | 6 | 27.5 | 2240.63 |
| PeNi1 | Pelophylax nigromaculatus | GLLGKVLGVGKKVLCGVTGLC | 21 | 3 | 70.0 | 2014.55 |
| PeNi2 | Pelophylax nigromaculatus | GLLGKVLGVGKKVLCVVSGLC | 21 | 3 | 70.0 | 2042.61 |
| PeNi3 | Pelophylax nigromaculatus | GIFSLIKGAAKVVAKGLG | 18 | 3 | 65.2 | 1729.12 |
| PeNi4 | Pelophylax nigromaculatus | GLLGKVLGVGKKVLC | 15 | 3 | 67.0 | 1483.91 |
| PeNi5 | Pelophylax nigromaculatus | GLLGKVLGVGKKVLCGVTGRERCQ | 24 | 4 | 57.7 | 2471.01 |
| PeNi7 | Bufo gargarizans, |
VIPFVASVAAEMMHHVYCAASKRCKN | 26 | 2 | 43.2 | 2863.42 |
| PeNi8 | Bufo gargarizans, |
GILLNTLKGAAKNVAGVLLDKLKCKITGGC | 30 | 4 | 63.0 | 3012.69 |
| PeNi9 | Leptobrachium boringii, Megophrys sangzhiensis, |
GLLGKILGVGKKVLCGVSGLC | 21 | 3 | 62.2 | 2014.55 |
| PeNi10 | Leptobrachium boringii, |
GLLLDTVKGAAKNVAGILLNKLKCKVTGDC | 30 | 3 | 61.8 | 3056.70 |
| PeNi11 | Leptobrachium boringii, |
GILTDTLKGAAKNVAGVLLDKLKCKITGGC | 30 | 3 | 61.8 | 3001.62 |
| PeNi14 | Bufo gargarizans, |
GLWTTIKEGVKNFSVGVLDKIRCKITGGC | 29 | 3 | 67.00 | 3123.71 |
| PoSn1 | Polistes snelleni | ISIKEALEHSFFHTVPRKWCKKH | 23 | 3 | 30.4 | 2822.31 |
| PoSn2 | Polistes snelleni | TALKSLSILKKLAKLNM | 17 | 4 | 23.7 | 1872.37 |
| RaCa15 | Rana catesbeiana | FLPVVAGLAAKVLPSIICAVTKKC | 24 | 3 | 67.0 | 2442.09 |
| RaOm2 | Rana omeimontis | GILSGLLGAGKKIVCGLSGMC | 21 | 2 | 80.0 | 1977.47 |
| RaOm3 | Rana omeimontis | GIFSLIKGAAKVVAKGLGK | 19 | 4 | 67.0 | 1857.30 |
| RaOm4 | Rana omeimontis | GLLGKVLGVGKKVLCGVSGRC | 21 | 4 | 67.0 | 2043.55 |
| RaSi1 | Allobates femoralis, |
GLVGKLVKGGLKLIGHVANG | 20 | 3 | 36.9 | 1930.35 |
| RaSy2 | Rana sylvatica | EEQRFLPVVAGLAAKVLPSIICAVTKKC | 28 | 2 | 21.9 | 2984.64 |
| TeBi1 | Tetramorium bicarinatum | KIKIPWGKVKDFLVGGMKAVGKK | 23 | 6 | 45.00 | 2528.17 |
| TeRu2 | Temnothorax rugatulus | AFVRILCYCCPRRIKRR | 17 | 6 | 31.9 | 2153.70 |
| TeRu4 | Temnothorax rugatulus | SWLSKSVKKLVNKKNYTRLEKLAKKKLFNE | 30 | 8 | 25.5 | 3622.33 |
* Net charge at pH = 7.
Supplementary Materials
The following supporting information can be downloaded at:
References
1. Murray, C.J.; Ikuta, K.S.; Sharara, F.; Swetschinski, L.; Robles Aguilar, G.; Gray, A.; Han, C.; Bisignano, C.; Rao, P.; Wool, E. et al. Global Burden of Bacterial Antimicrobial Resistance in 2019: A Systematic Analysis. Lancet; 2022; 399, pp. 629-655. [DOI: https://dx.doi.org/10.1016/S0140-6736(21)02724-0] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/35065702]
2. O’Neill, J. Antimicrobial Resistance: Tackling a Crisis for the Health and Wealth of Nations. The Review on Antimicrobial Resistance 2014; Available online: https://amr-review.org/sites/default/files/AMR%20Review%20Paper%20-%20Tackling%20a%20crisis%20for%20the%20health%20and%20wealth%20of%20nations_1.pdf (accessed on 31 October 2022).
3. Gillings, M.R.; Paulsen, I.T.; Tetu, S.G. Genomics and the Evolution of Antibiotic Resistance: Genomics and Antibiotic Resistance. Ann. N.Y. Acad. Sci.; 2017; 1388, pp. 92-107. [DOI: https://dx.doi.org/10.1111/nyas.13268] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/27768822]
4. Llor, C.; Bjerrum, L. Antimicrobial Resistance: Risk Associated with Antibiotic Overuse and Initiatives to Reduce the Problem. Ther. Adv. Drug Saf.; 2014; 5, pp. 229-241. [DOI: https://dx.doi.org/10.1177/2042098614554919] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/25436105]
5. Reardon, S. WHO Warns against “post-Antibiotic” Era. Nature; 2014; [DOI: https://dx.doi.org/10.1038/nature.2014.15135]
6. Durand, G.A.; Raoult, D.; Dubourg, G. Antibiotic Discovery: History, Methods and Perspectives. Int. J. Antimicrob. Agents; 2019; 53, pp. 371-382. [DOI: https://dx.doi.org/10.1016/j.ijantimicag.2018.11.010]
7. Cruz, J.; Ortiz, C.; Guzmán, F.; Fernández-Lafuente, R.; Torres, R. Antimicrobial Peptides: Promising Compounds against Pathogenic Microorganisms. CMC; 2014; 21, pp. 2299-2321. [DOI: https://dx.doi.org/10.2174/0929867321666140217110155]
8. Zasloff, M. Antimicrobial Peptides of Multicellular Organisms. Nature; 2002; 415, pp. 389-395. [DOI: https://dx.doi.org/10.1038/415389a]
9. Zhang, L.; Gallo, R.L. Antimicrobial Peptides. Curr. Biol.; 2016; 26, pp. R14-R19. [DOI: https://dx.doi.org/10.1016/j.cub.2015.11.017]
10. Petchiappan, A.; Chatterji, D. Antibiotic Resistance: Current Perspectives. ACS Omega; 2017; 2, pp. 7400-7409. [DOI: https://dx.doi.org/10.1021/acsomega.7b01368]
11. Rima, M.; Rima, M.; Fajloun, Z.; Sabatier, J.-M.; Bechinger, B.; Naas, T. Antimicrobial Peptides: A Potent Alternative to Antibiotics. Antibiotics; 2021; 10, 1095. [DOI: https://dx.doi.org/10.3390/antibiotics10091095]
12. Hancock, R.E.W.; Sahl, H.-G. Antimicrobial and Host-Defense Peptides as New Anti-Infective Therapeutic Strategies. Nat. Biotechnol.; 2006; 24, pp. 1551-1557. [DOI: https://dx.doi.org/10.1038/nbt1267]
13. Yu, G.; Baeder, D.Y.; Regoes, R.R.; Rolff, J. Predicting Drug Resistance Evolution: Insights from Antimicrobial Peptides and Antibiotics. Proc. R. Soc. B; 2018; 285, 20172687. [DOI: https://dx.doi.org/10.1098/rspb.2017.2687]
14. Andersson, D.I.; Hughes, D.; Kubicek-Sutherland, J.Z. Mechanisms and Consequences of Bacterial Resistance to Antimicrobial Peptides. Drug Resist. Updates; 2016; 26, pp. 43-57. [DOI: https://dx.doi.org/10.1016/j.drup.2016.04.002]
15. Meylan, S.; Andrews, I.W.; Collins, J.J. Targeting Antibiotic Tolerance, Pathogen by Pathogen. Cell; 2018; 172, pp. 1228-1238. [DOI: https://dx.doi.org/10.1016/j.cell.2018.01.037]
16. Koehbach, J.; Craik, D.J. The Vast Structural Diversity of Antimicrobial Peptides. Trends Pharmacol. Sci.; 2019; 40, pp. 517-528. [DOI: https://dx.doi.org/10.1016/j.tips.2019.04.012]
17. Mahlapuu, M.; Håkansson, J.; Ringstad, L.; Björn, C. Antimicrobial Peptides: An Emerging Category of Therapeutic Agents. Front. Cell. Infect. Microbiol.; 2016; 6, 194. [DOI: https://dx.doi.org/10.3389/fcimb.2016.00194]
18. Tossi, A.; Sandri, L.; Giangaspero, A. Amphipathic, α-Helical Antimicrobial Peptides. Biopolymers; 2000; 55, pp. 4-30. [DOI: https://dx.doi.org/10.1002/1097-0282(2000)55:1<4::AID-BIP30>3.0.CO;2-M]
19. Chen, C.H.; Bepler, T.; Pepper, K.; Fu, D.; Lu, T.K. Synthetic Molecular Evolution of Antimicrobial Peptides. Curr. Opin. Biotechnol.; 2022; 75, 102718. [DOI: https://dx.doi.org/10.1016/j.copbio.2022.102718]
20. Jumper, J.; Evans, R.; Pritzel, A.; Green, T.; Figurnov, M.; Ronneberger, O.; Tunyasuvunakool, K.; Bates, R.; Žídek, A.; Potapenko, A. et al. Highly Accurate Protein Structure Prediction with AlphaFold. Nature; 2021; 596, pp. 583-589. [DOI: https://dx.doi.org/10.1038/s41586-021-03819-2]
21. Mirdita, M.; Schütze, K.; Moriwaki, Y.; Heo, L.; Ovchinnikov, S.; Steinegger, M. ColabFold: Making Protein Folding Accessible to All. Nat. Methods; 2022; 19, pp. 679-682. [DOI: https://dx.doi.org/10.1038/s41592-022-01488-1]
22. Lin, D.; Sutherland, D.; Aninta, S.I.; Louie, N.; Nip, K.M.; Li, C.; Yanai, A.; Coombe, L.; Warren, R.L.; Helbing, C.C. et al. Mining Amphibian and Insect Transcriptomes for Antimicrobial Peptide Sequences with RAMPage. Antibiotics; 2022; 11, 952. [DOI: https://dx.doi.org/10.3390/antibiotics11070952] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/35884206]
23. World Health Organization. WHO Priority Pathogens List for R&D of New Antibiotics; WHO: Geneva, Switzerland, 2017.
24. Helbing, C.C.; Hammond, S.A.; Jackman, S.H.; Houston, S.; Warren, R.L.; Cameron, C.E.; Birol, I. Antimicrobial Peptides from Rana [Lithobates] Catesbeiana: Gene Structure and Bioinformatic Identification of Novel Forms from Tadpoles. Sci. Rep.; 2019; 9, 1529. [DOI: https://dx.doi.org/10.1038/s41598-018-38442-1] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/30728430]
25. Wu, Q.; Patočka, J.; Kuča, K. Insect Antimicrobial Peptides, a Mini Review. Toxins; 2018; 10, 461. [DOI: https://dx.doi.org/10.3390/toxins10110461] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/30413046]
26. Frishman, D.; Argos, P. Knowledge-Based Protein Secondary Structure Assignment. Proteins; 1995; 23, pp. 566-579. [DOI: https://dx.doi.org/10.1002/prot.340230412] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/8749853]
27. Clinical and Laboratory Standards Institute. Methods for Dilution Antimicrobial Susceptibility Tests for Bacteria That Grow Aerobically: Approved Standards; Clinical and Laboratory Standards Institute: Wayne, PA, USA, 2015.
28. Wiegand, I.; Hilpert, K.; Hancock, R.E.W. Agar and Broth Dilution Methods to Determine the Minimal Inhibitory Concentration (MIC) of Antimicrobial Substances. Nat. Protoc.; 2008; 3, pp. 163-175. [DOI: https://dx.doi.org/10.1038/nprot.2007.521]
29. NCBI Resource Coordinators. Database Resources of the National Center for Biotechnology Information. Nucleic Acids Res.; 2016; 44, pp. D7-D19. [DOI: https://dx.doi.org/10.1093/nar/gkv1290]
30. Li, W.-F.; Ma, G.-X.; Zhou, X.-X. Apidaecin-Type Peptides: Biodiversity, Structure–Function Relationships and Mode of Action. Peptides; 2006; 27, pp. 2350-2359. [DOI: https://dx.doi.org/10.1016/j.peptides.2006.03.016]
31. Greco, I.; Molchanova, N.; Holmedal, E.; Jenssen, H.; Hummel, B.D.; Watts, J.L.; Håkansson, J.; Hansen, P.R.; Svenson, J. Correlation between Hemolytic Activity, Cytotoxicity and Systemic in Vivo Toxicity of Synthetic Antimicrobial Peptides. Sci. Rep.; 2020; 10, 13206. [DOI: https://dx.doi.org/10.1038/s41598-020-69995-9]
32. Maher, S.; McClean, S. Investigation of the Cytotoxicity of Eukaryotic and Prokaryotic Antimicrobial Peptides in Intestinal Epithelial Cells in Vitro. Biochem. Pharmacol.; 2006; 71, pp. 1289-1298. [DOI: https://dx.doi.org/10.1016/j.bcp.2006.01.012]
33. Maturana, P.; Martinez, M.; Noguera, M.E.; Santos, N.C.; Disalvo, E.A.; Semorile, L.; Maffia, P.C.; Hollmann, A. Lipid Selectivity in Novel Antimicrobial Peptides: Implication on Antimicrobial and Hemolytic Activity. Colloids Surf. B Biointerfaces; 2017; 153, pp. 152-159. [DOI: https://dx.doi.org/10.1016/j.colsurfb.2017.02.003]
34. Ilić, N.; Novković, M.; Guida, F.; Xhindoli, D.; Benincasa, M.; Tossi, A.; Juretić, D. Selective Antimicrobial Activity and Mode of Action of Adepantins, Glycine-Rich Peptide Antibiotics Based on Anuran Antimicrobial Peptide Sequences. Biochim. Biophys. Acta (BBA)-Biomembr.; 2013; 1828, pp. 1004-1012. [DOI: https://dx.doi.org/10.1016/j.bbamem.2012.11.017]
35. Conlon, J.M. Reflections on a Systematic Nomenclature for Antimicrobial Peptides from the Skins of Frogs of the Family Ranidae. Peptides; 2008; 29, pp. 1815-1819. [DOI: https://dx.doi.org/10.1016/j.peptides.2008.05.029]
36. Savelyeva, A.; Ghavami, S.; Davoodpour, P.; Asoodeh, A.; Łos, M.J. An Overview of Brevinin Superfamily: Structure, Function and Clinical Perspectives. Anticancer Genes; Grimm, S. Advances in Experimental Medicine and Biology Springer: London, UK, 2014; Volume 818, pp. 197-212. ISBN 978-1-4471-6457-9
37. Park, S.; Park, S.-H.; Ahn, H.-C.; Kim, S.; Kim, S.S.; Lee, B.J.; Lee, B.-J. Structural Study of Novel Antimicrobial Peptides, Nigrocins, Isolated from Rana Nigromaculata. FEBS Lett.; 2001; 507, pp. 95-100. [DOI: https://dx.doi.org/10.1016/S0014-5793(01)02956-8]
38. Conlon, J.M.; Ahmed, E.; Condamine, E. Antimicrobial Properties of Brevinin-2-Related Peptide and Its Analogs: Efficacy Against Multidrug-Resistant Acinetobacter Baumannii. Chem. Biol. Drug Des.; 2009; 74, pp. 488-493. [DOI: https://dx.doi.org/10.1111/j.1747-0285.2009.00882.x]
39. Wang, G. Post-Translational Modifications of Natural Antimicrobial Peptides and Strategies for Peptide Engineering. CBIOT; 2012; 1, pp. 72-79. [DOI: https://dx.doi.org/10.2174/2211550111201010072]
40. Strandberg, E.; Tiltak, D.; Ieronimo, M.; Kanithasen, N.; Wadhwani, P.; Ulrich, A.S. Influence of C-Terminal Amidation on the Antimicrobial and Hemolytic Activities of Cationic α-Helical Peptides. Pure Appl. Chem.; 2007; 79, pp. 717-728. [DOI: https://dx.doi.org/10.1351/pac200779040717]
41. Mangoni, M.L.; Papo, N.; Mignogna, G.; Andreu, D.; Shai, Y.; Barra, D.; Simmaco, M. Ranacyclins, a New Family of Short Cyclic Antimicrobial Peptides: Biological Function, Mode of Action, and Parameters Involved in Target Specificity. Biochemistry; 2003; 42, pp. 14023-14035. [DOI: https://dx.doi.org/10.1021/bi034521l]
42. Rifflet, A.; Gavalda, S.; Téné, N.; Orivel, J.; Leprince, J.; Guilhaudis, L.; Génin, E.; Vétillard, A.; Treilhou, M. Identification and Characterization of a Novel Antimicrobial Peptide from the Venom of the Ant Tetramorium Bicarinatum. Peptides; 2012; 38, pp. 363-370. [DOI: https://dx.doi.org/10.1016/j.peptides.2012.08.018]
43. Chen, S.; Zhou, Y.; Chen, Y.; Gu, J. Fastp: An Ultra-Fast All-in-One FASTQ Preprocessor. Bioinformatics; 2018; 34, pp. i884-i890. [DOI: https://dx.doi.org/10.1093/bioinformatics/bty560]
44. Nip, K.M.; Chiu, R.; Yang, C.; Chu, J.; Mohamadi, H.; Warren, R.L.; Birol, I. RNA-Bloom Enables Reference-Free and Reference-Guided Sequence Assembly for Single-Cell Transcriptomes. Genome Res.; 2020; 30, pp. 1191-1200. [DOI: https://dx.doi.org/10.1101/gr.260174.119]
45. Haas, B.J.; Papanicolaou, A.; Yassour, M.; Grabherr, M.; Blood, P.D.; Bowden, J.; Couger, M.B.; Eccles, D.; Li, B.; Lieber, M. et al. De Novo Transcript Sequence Reconstruction from RNA-Seq Using the Trinity Platform for Reference Generation and Analysis. Nat. Protoc.; 2013; 8, pp. 1494-1512. [DOI: https://dx.doi.org/10.1038/nprot.2013.084] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/23845962]
46. Johnson, L.S.; Eddy, S.R.; Portugaly, E. Hidden Markov Model Speed Heuristic and Iterative HMM Search Procedure. BMC Bioinform.; 2010; 11, 431. [DOI: https://dx.doi.org/10.1186/1471-2105-11-431] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/20718988]
47. Duckert, P.; Brunak, S.; Blom, N. Prediction of Proprotein Convertase Cleavage Sites. Protein Eng. Des. Sel.; 2004; 17, pp. 107-112. [DOI: https://dx.doi.org/10.1093/protein/gzh013] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/14985543]
48. Li, C.; Sutherland, D.; Hammond, S.A.; Yang, C.; Taho, F.; Bergman, L.; Houston, S.; Warren, R.L.; Wong, T.; Hoang, L.M.N. et al. AMPlify: Attentive Deep Learning Model for Discovery of Novel Antimicrobial Peptides Effective against WHO Priority Pathogens. BMC Genom.; 2022; 23, 77. [DOI: https://dx.doi.org/10.1186/s12864-022-08310-4] [PubMed: https://www.ncbi.nlm.nih.gov/pubmed/35078402]
49. Hart, A.J.; Ginzburg, S.; Xu, M.; Fisher, C.R.; Rahmatpour, N.; Mitton, J.B.; Paul, R.; Wegrzyn, J.L. EnTAP : Bringing Faster and Smarter Functional Annotation to Non-model Eukaryotic Transcriptomes. Mol. Ecol. Resour.; 2020; 20, pp. 591-604. [DOI: https://dx.doi.org/10.1111/1755-0998.13106]
50. Slater, G.; Birney, E. Automated Generation of Heuristics for Biological Sequence Comparison. BMC Bioinform.; 2005; 6, 31. [DOI: https://dx.doi.org/10.1186/1471-2105-6-31]
51. Adamczak, R.; Porollo, A.; Meller, J. Combining Prediction of Secondary Structure and Solvent Accessibility in Proteins. Proteins; 2005; 59, pp. 467-475. [DOI: https://dx.doi.org/10.1002/prot.20441]
52. Fu, L.; Niu, B.; Zhu, Z.; Wu, S.; Li, W. CD-HIT: Accelerated for Clustering the next-Generation Sequencing Data. Bioinformatics; 2012; 28, pp. 3150-3152. [DOI: https://dx.doi.org/10.1093/bioinformatics/bts565]
53. Dong, R.; Peng, Z.; Zhang, Y.; Yang, J. MTM-Align: An Algorithm for Fast and Accurate Multiple Protein Structure Alignment. Bioinformatics; 2018; 34, pp. 1719-1725. [DOI: https://dx.doi.org/10.1093/bioinformatics/btx828]
54. Virtanen, P.; Gommers, R.; Oliphant, T.E.; Haberland, M.; Reddy, T.; Cournapeau, D.; Burovski, E.; Peterson, P.; Weckesser, W.; Bright, J. et al. SciPy 1.0: Fundamental Algorithms for Scientific Computing in Python. Nat. Methods; 2020; 17, pp. 261-272. [DOI: https://dx.doi.org/10.1038/s41592-019-0686-2]
55. Jones, P.; Binns, D.; Chang, H.-Y.; Fraser, M.; Li, W.; McAnulla, C.; McWilliam, H.; Maslen, J.; Mitchell, A.; Nuka, G. et al. InterProScan 5: Genome-Scale Protein Function Classification. Bioinformatics; 2014; 30, pp. 1236-1240. [DOI: https://dx.doi.org/10.1093/bioinformatics/btu031]
56. Palme, J.; Hochreiter, S.; Bodenhofer, U. KeBABS: An R Package for Kernel-Based Analysis of Biological Sequences. Bioinformatics; 2015; 31, pp. 2574-2576. [DOI: https://dx.doi.org/10.1093/bioinformatics/btv176]
57. Charif, D.; Lobry, J.R. SeqinR 1.0-2: A Contributed Package to the R Project for Statistical Computing Devoted to Biological Sequences Retrieval and Analysis. Structural Approaches to Sequence Evolution; Bastolla, U.; Porto, M.; Roman, H.E.; Vendruscolo, M. Biological and Medical Physics, Biomedical Engineering Springer: Berlin/Heidelberg, Germany, 2007; pp. 207-232. ISBN 978-3-540-35305-8
58. Yu, G.; Smith, D.K.; Zhu, H.; Guan, Y.; Lam, T.T. ggtree: An r Package for Visualization and Annotation of Phylogenetic Trees with Their Covariates and Other Associated Data. Methods Ecol. Evol.; 2017; 8, pp. 28-36. [DOI: https://dx.doi.org/10.1111/2041-210X.12628]
59. Yu, G.; Lam, T.T.-Y.; Zhu, H.; Guan, Y. Two Methods for Mapping and Visualizing Associated Data on Phylogeny Using Ggtree. Mol. Biol. Evol.; 2018; 35, pp. 3041-3043. [DOI: https://dx.doi.org/10.1093/molbev/msy194]
60. Yu, G. Using Ggtree to Visualize Data on Tree-Like Structures. Curr. Protoc. Bioinform.; 2020; 69, e96. [DOI: https://dx.doi.org/10.1002/cpbi.96]
61. Yu, G. Data Integration, Manipulation and Visualization of Phylogenetic Trees; 1st ed. Chapman and Hall/CRC: Boca Raton, FL, USA, 2022.
62. Paradis, E.; Schliep, K. Ape 5.0: An Environment for Modern Phylogenetics and Evolutionary Analyses in R. Bioinformatics; 2019; 35, pp. 526-528. [DOI: https://dx.doi.org/10.1093/bioinformatics/bty633]
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). Notwithstanding the ProQuest Terms and Conditions, you may use this content in accordance with the terms of the License.
Abstract
Antimicrobial peptides (AMPs) are a diverse class of short, often cationic biological molecules that present promising opportunities in the development of new therapeutics to combat antimicrobial resistance. Newly developed in silico methods offer the ability to rapidly discover numerous novel AMPs with a variety of physiochemical properties. Herein, using the rAMPage AMP discovery pipeline, we bioinformatically identified 51 AMP candidates from amphibia and insect RNA-seq data and present their in-depth characterization. The studied AMPs demonstrate activity against a panel of bacterial pathogens and have undetected or low toxicity to red blood cells and human cultured cells. Amino acid sequence analysis revealed that 30 of these bioactive peptides belong to either the Brevinin-1, Brevinin-2, Nigrocin-2, or Apidaecin AMP families. Prediction of three-dimensional structures using ColabFold indicated an association between peptides predicted to adopt a helical structure and broad-spectrum antibacterial activity against the Gram-negative and Gram-positive species tested in our panel. These findings highlight the utility of associating the diverse sequences of novel AMPs with their estimated peptide structures in categorizing AMPs and predicting their antimicrobial activity.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
Details
; Sutherland, Darcy 2
; Ebrahimikondori, Hossein 3 ; Babcock, Alana 4 ; Louie, Nathan 1 ; Li, Chenkai 3
; Coombe, Lauren 5
; Lin, Diana 5
; Warren, René L 5
; Yanai, Anat 1
; Kotkoff, Monica 5 ; Helbing, Caren C 6
; Hof, Fraser 4
; Hoang, Linda M N 7 ; Inanc Birol 8
1 Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada; British Columbia Centre for Disease Control, Public Health Laboratory, Vancouver, BC V6Z R4R, Canada
2 Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada; British Columbia Centre for Disease Control, Public Health Laboratory, Vancouver, BC V6Z R4R, Canada; Department of Pathology and Laboratory Medicine, University of British Columbia, Vancouver, BC V6T 1Z4, Canada
3 Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada; Bioinformatics Graduate Program, University of British Columbia, Vancouver, BC V6T 1Z4, Canada
4 Department of Chemistry and the Centre for Advanced Materials and Related Technology, University of Victoria, Victoria, BC V8W 3V6, Canada
5 Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada
6 Department of Biochemistry and Microbiology, University of Victoria, Victoria, BC V8P 5C2, Canada
7 British Columbia Centre for Disease Control, Public Health Laboratory, Vancouver, BC V6Z R4R, Canada; Department of Pathology and Laboratory Medicine, University of British Columbia, Vancouver, BC V6T 1Z4, Canada
8 Canada’s Michael Smith Genome Sciences Centre at BC Cancer, Vancouver, BC V5Z 4S6, Canada; British Columbia Centre for Disease Control, Public Health Laboratory, Vancouver, BC V6Z R4R, Canada; Department of Pathology and Laboratory Medicine, University of British Columbia, Vancouver, BC V6T 1Z4, Canada; Department of Medical Genetics, University of British Columbia, Vancouver, BC V6T 1Z3, Canada




