Citation:Tseng K-Y, Huang Y-T, Huang Y-T, Su Y-T, Wang A-N, Weng W-Y, et al. (2024) Regulation of candidalysin underlies Candida albicans persistence in intravascular catheters by modulating NETosis. PLoS Pathog 20(6): e1012319. https://doi.org/10.1371/journal.ppat.1012319
Editor:Scott G. Filler, University of California Los Angeles David Geffen School of Medicine, UNITED STATES
Received:January 12, 2024; Accepted:June 6, 2024; Published: June 17, 2024
Copyright: © 2024 Tseng et al. This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Data Availability:All relevant data are within the manuscript and its Supporting Information files.
Funding:This work was supported by National Science and Technology Council, Taiwan (106-2321-B-010-015-MY3, 110-2320-B-A49A-544 -MY3, 111-2314-B-A49-046, 112-2314-B-A49-067) to YHT, and NYMU-FEMH Joint Research Program (109DN33) to YHT. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Competing interests: The authors have declared that no competing interests exist.
Introduction
Invasive candidiasis, including the bloodstream infection called candidemia, is infection of Candida species at sterile sites in human body [1]. Candida albicans accounts for more than half of candidiasis with the mortality rate of up to 40%. Invasive candidiasis is highly associated with the use of intravascular catheters, where the catheters are considered to be colonized by C. albicans as biofilms before the microbes disseminate into the blood.
Microbial biofilms are communities of aggregated microbial cells. Biofilms are the predominant growth state on a surface of many microorganisms, including environmental microbes and clinically important pathogens [2–4]. C. albicans biofilms can be found on the intravascular catheters from patients and the mucosal surfaces in vivo in mouse models [5–7]. Once it forms on a intravascular catheter, C. albicans cells within the biofilms can potentially disseminate to bloodstream to cause systemic candidiasis and deep-seated tissue infection [1,5]. High intravascular antifungal doses together with removal of the contaminated catheters are generally required to treat the infections, even though this management can cause serious complications and are costly [8–10]. Biofilm formation capacity of C. albicans is thus suggested to be critical for candidiasis, especially in patients with intravascular catheters [1,4].
Catheters are medical devices implanted into patients for therapeutic purposes. A central venous catheter is a tube placed into a large vein to give medications to patients. Patients who have central venous catheters often receive medications, such as antimicrobials, immunosuppressant, and total parenteral nutrition (TPN) via the catheters [11,12]. These medications can modulate the physiology of the fungi and immune cells and therefore the consequence of the interactions between fungi and immune cells in blood and catheters [12–17].
C. albicans is a dimorphic fungus capable of thriving a wide range of extreme environments [18]. The morphological transition takes place at 37°C and confers biofilm formation. The yeast-to-hypha filamentation process is required for C. albicans full virulence. It has been demonstrated that expression of C. albicans virulence genes, such as ECE1, is associated with filamentation and finely regulated by transcription factors controlling morphological transition [19,20]. Accordingly, C. albicans locked in either yeast or filamentous form due to ablation of the transcription factors is less virulent and may show decreased biofilm formation capacity than the parental strain [20–23].
Various in vitro models have been established to recapitulate C. albicans biofilm formation on an intravascular catheter in clinical infections, mainly focusing on the use of relevant plastic materials for microbial adhesion [24–28]. C. albicans biofilm formation is generally thought to comprise four stages: (i) adherence of spherical yeast cells to a surface, (ii) initiation of cell proliferation to form a basal layer of anchoring cells, (iii) formation of filamentous structure concomitant with extracellular matrix production, and (iv) dispersal of yeast-form cells from the biofilm mass to seed a new site [4]. Multiple transcriptional regulators were identified in C. albicans, mostly in the reference strain SC5314, to be critical for biofilm formation [29]. Non-regulatory genes such as ALS family genes and HWP, which are highly expressed in filamentation growth, are also involved in biofilm formation [4]. However, these studies have overlooked potential biodiversity of C. albicans, in which biofilm formation capacity has been demonstrated to be heterogeneous among the clinical isolates [30–32].
While biofilm formation has been proposed to be critical for clinical isolates to achieve successful colonization and infection, clinical isolates appeared to exhibit lower biofilm formation capacity as compared to several domestic reference strains derived from SC5314, which was isolated before the 1980s [23]. The high biofilm formation capacity of SC5314 can be partly attributed to a gain-of-function mutation in ROB1, which has not been found in C. albicans clinical isolates [23]. This suggests that the evolution of C. albicans may be shaped by additional factors that would not result in selection of the gain-of-function mutation in ROB1.
In this study, we aimed to identify the host factors shaping C. albicans biofilm formation in intravascular catheters. We characterized the biofilms on the intravascular catheters removed from candidiasis patients with multi-photon microscopy. We detected infiltration of immune cells associated with fungal cells at the inner surfaces of the catheters. In some but not all the catheters, we noticed the presence of neutrophil extracellular traps (NETs), NET-like structures (NLS), and cells undergoing NETosis, a type of neutrophil cell death resulting in release of NETs and NLS. We further characterized the C. albicans isolates from the catheters under TPN environment, and showed that these clinical isolates exhibit low expression of candidalysin. The isolates that can resist neutrophil-mediated biofilm removal under TPN environment in vitro also showed undetectable NETosis in the corresponding intravascular catheters. Whereas, supplementation of candidalysin induced NETosis and facilitated the removal of C. albicans biofilms. Our findings reveal the importance of candidalysin downregulation in C. albicans persistence in intravascular catheters.
Results
Detection of fungal biofilms at the inner surfaces of the intravascular catheters from candidiasis patients
We collected nine intravascular catheters removed from candidiasis patients where the catheters were also reported to be positive of C. albicans culture. A high fungal load (> 10 CFUs) in tip culture was found in six of the catheters. These patients did not receive any antifungal within 3 days before catheter removal (Table 1). We investigated the colonization sites of C. albicans by imaging the cross sections of the catheters for any unusual cell aggregation, which would potentially be fungal biofilms (Fig 1). While the outer surfaces of the intravascular catheters were completely smooth without any possible biofilms, aggregation of cells was noted at the inner luminal surfaces of all the six catheters (Fig 1).
[Figure omitted. See PDF.]
Fig 1. Identification of biofilms at the inner surfaces of the catheters removed from candidemia patients.
The catheters were taken for cross-section imaging by bright field microscopy. Magnified images of the inner and outer surfaces of the catheters were shown in red and blue boxes as indicated. Scale bar, 500 μm for whole catheters, and 20 μm for magnified inner and outer surfaces.
https://doi.org/10.1371/journal.ppat.1012319.g001
[Figure omitted. See PDF.]
Table 1. Clinical summary of the patients.
https://doi.org/10.1371/journal.ppat.1012319.t001
To validate the presence of fungal cells within the cell aggregates at the inner surface, we stained the sections of the intravascular catheters by Periodic acid-Schiff (PAS) staining (Fig 2A). The PAS+ fungal cells appeared to be filamentous and associated with a fibrous structure in the catheters removed from patients NTUH001 and NTUH005. Whereas, the fungal cells in the intravascular catheters of patients NTUH016 and NTUH019 showed yeast morphology, and those of patient NTUH042 exhibited aggregation (Fig 2A). Hematoxylin and eosin staining (H&E) was performed to address potential infiltration of immune cells in the intravascular catheters (Fig 2B). We observed the infiltration of polymorphonuclear cells (PMNs) associated with the fibrous structure in the lumen of the intravascular catheters, which were highly abundant in the catheter of NTUH005 and to a lesser content in that of NTUH001 (Fig 2B). Briefly, these data show the presence of biofilms, comprising both fungal cells and immune cells specifically at the luminal surfaces of the intravascular catheters removed from candidiasis patients.
[Figure omitted. See PDF.]
Fig 2. Detection of fungal cells at the inner surfaces of the catheters.
The catheters were fixed with paraformaldehyde followed by paraffin embedding and sectioning to 10 μm thickness. (A) Periodic acid-Schiff (PAS) staining was performed to detect fungal cells in the catheters. Fungal cells are indicated by yellow arrows. (B) Hematoxylin and eosin staining (H&E) was applied for detection of human cell components. Polymorphonuclear cells associated with a fibrous structure are indicated by red arrows. Scale bar, 500 μm for whole catheters, and 50 μm for magnified images at the inner surfaces of the catheters.
https://doi.org/10.1371/journal.ppat.1012319.g002
The Candida-associated immune cells in the catheters displayed diverse phenotypes
To validate the presence of C. albicans and human immune cells in the cell aggregation observed at the inner surfaces of the catheters, we imaged the cross-section view of the whole catheter by two-photon microscopy to preserve the structure of the biofilms associated to the catheters. We demonstrated that the biomass at the luminal surfaces of the catheters was recognized by an anti-Candida antibody (Fig 3) as well as calcofluor white (Fig 4A), both of which stain C. albicans cells, suggesting the presence of Candida cells there. In addition to the fungal cells showing yeast or filamentous morphology were recognized by the anti-Candida antibody (Fig 3, white arrows), we found that some infiltrating CD45+ F-actin+ immune cells, especially those in the intravascular catheters of NTUH001 and NTUH005, also showed positive of Candida staining (Fig 3, magenta arrows). This was possibly due to internalization of Candida antigens by these cells or association of NLS released by NETotic cells with damaged fungal cells. We also observed the presence of CD45+ F-actin- cells showing actin cytoskeleton disassembly, a hallmark of early NETosis of neutrophils, associated with Candida antigens in the clusters (Fig 3, yellow arrows) [33,34]. Of note, these CD45+ F-actin- cells were not associated with Candida cells in the catheters of NTUH016, NTUH019, NTUH037 and NTUH042 (Fig 3). The lack of CD45+ F-actin- cells in these catheters was not due to lower number of white blood cells (WBC) in these patients as all the patients showed comparable counts of WBC in the blood (Table 1).
[Figure omitted. See PDF.]
Fig 3. Infiltration of human immune cells and their association with Candida cells at the inner surfaces of the catheters.
Whole mount catheters (2 mm in length) were fixed and stained for the presence of Candida cells and human immune cells, followed by observation under a two-photon microscope. Single xy-plane images are shown. Candida cells and human CD45+ F-actin+ immune cells associated with Candida antigens are indicated by white and magenta arrows, respectively. CD45+ F-actin- immune cells showing actin cytoskeleton disassembly are indicated by yellow arrows. Scale bar, 20 μm.
https://doi.org/10.1371/journal.ppat.1012319.g003
[Figure omitted. See PDF.]
Fig 4. Neutrophil extracellular traps were associated with Candida cells in the catheters.
The catheters were processed as described in Fig 3. Antibodies against citrullinated histone H3 (C-H3) were used to detect neutrophil extracellular traps (NETs). Candida cells were stained by Calcofluor white. Immune cells were identified by F-actin staining with phalloidin. (A) Single xy-plane and reconstituted 3D (z = 60 μm) images are shown. Candida cells associated with NETs are indicated by magenta arrows, while Candida cells free from NETs are indicated by white arrows. Scale bar, 20 μm. (B) Violin plot for comparison of NETs quantified by the volume of C-H3 signals in the stacked images obtained from the catheters. n = 3 to 9. Each point represents one stacked image.
https://doi.org/10.1371/journal.ppat.1012319.g004
The presence of CD45+ F-actin- cells led us to investigate the existence of NETosis in the intravascular catheters using an antibody recognizing citrullinated histone H3 (citH3), which is a marker for NETotic cells, NLS and NETs (Fig 4) [35]. We demonstrated that in the catheter of NTUH005 there was a high abundance of citH3+ NLS capturing fungal cells (Fig 4A, NTUH005, magenta arrows). We also detected citH3+ F-actin- cells, which represent NETotic cells, associated with fungal cells in the catheter of NTUH001 (Fig 4A, NTUH001, magenta arrows). In contrast, neither the citH3+ NLS nor the citH3+ F-actin- cells were seen in the other intravascular catheters (Fig 4A, NTUH016, NTUH019, NTUH037 and NTUH042). Quantification of citH3 volume in the catheters indicates that citH3+ NETotic cells, NLS and NETs were rare in the catheters of NTUH016, NTUH019, NTUH037 and NTUH042, but highly abundant in that of NTUH005 (Fig 4B). Of note, while filamentous structure has been demonstrated to be the major form of C. albicans biofilms, we did not observe a cluster of filamentous fungal cells in the catheters, and most of the fungal cells displayed short filament and yeast morphology in the intravascular catheters (Figs 3 and 4A). These findings show that the biofilms on the intravascular catheters contain infiltrating immune cells, which may undergo NETosis to exert antifungal activity.
The catheter isolates exhibit distinct filamentation capacity and virulence gene expression compared to the reference strain SC5314
Filamentous fungal cells have been shown to be the primary form of C. albicans in biofilms and infected tissues [4]. However, we found a paucity of filamentous structure of C. albicans in the catheters (Figs 3 and 4A). It has been demonstrated that a natural clinical variant of C. albicans that cannot produce filaments displayed poor phagocytosis by neutrophils, and relatively low ROS and NETs accumulation, thereby resisting neutrophil-mediated killing [36]. We thus tested filamentation capacity of the catheter isolates (Fig 5). We incubated the catheter isolates in complete RPMI 1640 medium containing 10% serum (RPMI), a culture environment that has been demonstrated to promote Candida filamentation and biofilm formation [37]. All the catheter isolates displayed filamentation capacity that is comparable to the reference strain SC5314 in RPMI in planktonic culture (Fig 5A). The filamentous cells can also be observed in biofilms of all the catheter isolates cultured in RPMI, but less abundant in those of NTUH001 and NTUH005 isolates (S2 Fig, Candida). Briefly, all the catheter isolates possess filamentation capacity in the filamentation inducing environment, but the adhesion capacity of the filamentous cells may vary among the isolates.
[Figure omitted. See PDF.]
Fig 5. Morphology of the catheter isolates cultured in RPMI or TPN.
C. albicans cells were cultured in RPMI medium (A) or TPN (B) for 24 hours at 37°C, 180 rpm. The cells were fixed by 4% paraformaldehyde followed by Concanavalin A (Con A) staining to detect mannan. Represented images are shown. BF, bright field. Scale bar: 20 μm.
https://doi.org/10.1371/journal.ppat.1012319.g005
The presence of biofilms specifically at the luminal surfaces of the catheters but not at the outer surfaces suggests that the environment in the catheter lumen is an important factor modulating fungal cell persistence on the catheter. TPN infusion is highly associated with candidiasis, can be found in more than 90% of candidemia patients [38,39]. Accordingly, 3 out of the 6 patients in this study received TPN at the time of candidiasis (Table 1). We thus tested filamentation capacity of the catheter isolates in TPN (Fig 5B). We found that all the catheter isolates showed reduced filamentation in TPN as compared to those in RPMI, and mainly presented yeasts or pseudohyphae in aggregates when cultured in TPN (Fig 5B). Whereas, the reference strain SC5314 preserved filamentation capacity forming true hyphae in TPN (Fig 5B). These data suggest that components in TPN may suppress C. albicans filamentation, especially in the catheter isolates.
C. albicans filamentous morphogenesis is intricately regulated by several transcription factors. Nrg1 functions as a core negative regulator suppressing filamentation, while Efg1 is a negative regulator of Nrg1, thereby inducing filamentation [40]. We hypothesized that the antagonistic regulation between Efg1 and Nrg1 may underlie the morphogenesis regulation specifically in TPN. Unexpectedly, all the catheter isolates showed comparable expression of EFG1 and NRG1 to SC5314 in RPMI and in TPN (Fig 6A and 6B, EFG1 and NRG1). Notably, relative expression of these genes to ACT1 was also comparable between RPMI and TPN in all the strains (Fig 6A and 6B, EFG1 and NRG1). This suggests that the filamentation modulation by TPN is downstream of EFG1-NRG1 regulation. We also showed that expression of YWP1, a yeast-associated gene, was comparable among all the strains in both culture environments (Fig 6A and 6B, YWP1). Expression of filamentation-associated genes were also addressed. Except for NTUH001 isolate, we found that the other catheter isolates showed significantly reduced expression of HWP1 in both RPMI and TPN cultures (Fig 6A and 6B, HWP1). We also studied the expression of ECE1, which encodes a NETosis-inducing fungal toxin called candidalysin highly expressed by hyphal filaments [41]. We demonstrated that all the catheter isolates showed an approximately 3-fold reduction in ECE1 expression compared to that of SC5314 in RPMI, and the reduction was more than 10-fold in TPN (Fig 6A and 6B, ECE1). Nevertheless, expression of ALS3 and HGC1, the filamentation-associated genes whose expression are less varied among clinical isolates of C. albicans [42], was comparable among the catheter isolates and SC5314 in both RPMI and TPN culture environments (S1A and S1B Fig). These data demonstrate that the catheter isolates showed a reduction of specific filamentation-associated genes, such as ECE1, especially when cultured in TPN.
[Figure omitted. See PDF.]
Fig 6. The C. albicans catheter isolates exhibited reduced expression of specific filamentation-associated genes.
C. albicans yeast cells were cultured in RPMI (A) or TPN (B) at 37°C for 24 hours. Gene expression was quantified by qRT-PCR and normalized to ACT1 expression. Data represent mean with SD from three independent experiments. Statistical analysis was performed with the one-way ANOVA, followed by Dunnett’s multiple comparison test as compared to the reference strain SC5314. *, P<0.05. **, P<0.01. ***, P<0.001. ****, P<0.0001. NS, no significant difference.
https://doi.org/10.1371/journal.ppat.1012319.g006
The interaction of neutrophils with the biofilms of the catheter isolates varied
The distinct biofilm structure and immune cell properties in the intravascular catheters led us to investigate the biofilm structure of the catheter isolates, and the interaction of the biofilms with immune cells (Figs 2–4). The biofilms of these isolates displayed almost single-layer structure in TPN (Fig 7A, Candida). Biofilm formation capacity in TPN varied among the clinical isolates, where the isolates of NTUH019 and NTUH037 showed the lowest biofilm area and reduced filamentation in the biofilms (Fig 7A and 7B, Candida). We then studied the interaction between C. albicans biofilms and mouse bone marrow derived neutrophils (BMN) in TPN. While further incubation with mouse BMN reduced the biofilms of NTUH001 and NTUH005 isolates, these immune cells did not modulate the biofilms of NTUH016 and NTUH037 isolates, but even increased the biofilms of NTUH019 and NTUH042 isolates (Fig 7A and 7B, Candida and Candida + BMN). The biofilms of NTUH001 and NTUH005 isolates did not contain more neutrophils, suggesting that the ability of the other isolates to resist BMN-mediated biofilm elimination was not due to decreased neutrophil infiltration to the biofilms of these isolates (Fig 7A–7C, Candida + BMN).
[Figure omitted. See PDF.]
Fig 7. The catheter isolates exhibited diverse capacity in resistance to neutrophil-mediated fungal biofilm removal.
C. albicans cells were cultured in TPN for 24 hours to allow biofilm formation on a coverslip. The biofilms developed in TPN were then incubated with mouse bone marrow-derived neutrophils (BMN) in TPN in the absence or presence of candidalysin (CaL, 15 μM) for another 6 hours before fixation and staining. BMN NETosis was observed by Ly6G (cyan), F-actin (white) and citrullinated histone H3 staining (C-H3, red). Candida cells were stained by mDectin-1-Fc (green) that recognizes β-glucan on fungal cell wall. (A) Representative images are shown. (B) Candida biofilms were quantified as the area of C. albicans cells in each field on the coverslips. (C) Infiltration of BMNs (Ly6G+) into the surface-associated biofilms of each isolate is shown. (D and E) The percentage of NETotic BMNs (C-H3+ Ly6G+ cells/ total Ly6G+ cells) (D) and viable non- NETotic (F-actin+ C-H3- Ly6G+ cells/ total Ly6G+ cells) (E) in the biofilms is shown. All the images were analyzed with Imaris (Bitplane). (B-E) Results shown are mean with SD from 3 independent experiments, 2 images from each coverslip. Statistical analysis was performed with the one-way ANOVA, followed by Tukey’s multiple comparison test (B) or a two-tailed unpaired Student T test (C-E). *, P<0.05. **, P<0.01. ***, P<0.001. ****, P<0.0001. NS, no significant difference. Scale bar, 50 μm.
https://doi.org/10.1371/journal.ppat.1012319.g007
Due to the low expression of ECE1 in the clinical isolates, we hypothesized that candidalysin-induced NETosis can affect C. albicans biofilm persistence modulated by neutrophils [41]. Accordingly, we were able to detect NETotic cells expressing Ly6G and citH3 with deformed F-actin cytoskeleton, which were relatively fewer in the biofilms of NTUH037 and NTUH042 isolates in TPN (Fig 7A and 7D, Candida + BMN). The lower NETosis induction property of NTUH037 and NTUH042 isolates was also in line with higher viability of neutrophils with structured F-actin cytoskeleton (Fig 7A and 7E, Candida + BMN). In contrast to the TPN culture, culture of BMN with the biofilms in RPMI removed the biofilms of most of the catheter isolates as well as that of SC5314 (S2A and S2B Fig).
To address the potential involvement of low ECE1 expression of the catheter isolates in NETosis induction and resistance to BMN-mediated fungal biofilm elimination, we treated candidalysin peptides (Ece1-III62-93) together with BMN to C. albicans biofilms in TPN environment. Candidalysin supplementation significantly reduced the biofilms of almost all the catheter isolates except for that of NTUH005 isolate (Fig 7A and 7B). The treatment largely reduced the number of BMN associated with the biofilms possibly due to the shedding of biofilms together with NETotic BMN (Fig 7C). In contrast, candidalysin treatment had no effect on NETosis in the biofilms of NTUH001 and NTUH005 isolates, which showed more NETotic BMN in the absence of candidalysin (Fig 7A and 7D, NTUH001 and NTUH005). Whereas, candidalysin promoted NETosis and decreased F-actin+ BMN when incubated with the biofilms of the other catheter isolates (Fig 7A, 7D and 7E, NTUH016, NTUH019, NTUH037 and NTUH042). Candidalysin treatment in RPMI did not further induce NETosis when incubated with C. albicans biofilms, but even decreased the number of NETotic cells in the biofilms of NTUH001 isolate (S2C Fig). This suggests that the effect of candidalysin supplementation on NETosis in C. albicans biofilms was specific to TPN environment. Briefly, the catheter isolates from NTUH016, NTUH019, NTUH037 and NTUH042 can resist BMN-mediated biofilm removal specifically in TPN environment. The resistance can be overcome by candidalysin supplementation which triggers NETosis in the biofilms.
Disruption of candidalysin expression reduced NETosis of biofilm infiltrating neutrophils and enhanced C. albicans biofilm persistence in the presence of neutrophils
We specifically investigated the effect of candidalysin on NETosis and C. albicans biofilm persistence on a surface in TPN environment using the reference strain SC5314 and its isogenic candidalysin deficient mutants (ece1Δ/Δ, ece1Δ/Δ+ECE1Δ184–279 [I] and ece1Δ/Δ+ECE1Δ184–279 [II]) (Fig 8). We demonstrated that BMN was able to remove the biofilm of the wild-type SC5314, but increased that of the three candidalysin deficient mutants (Fig 8A and 8B). There were more Ly6G+ BMN infiltrating into the biofilm of the candidalysin deficient mutants, but the percentage of NETotic BMN was lower accompanying by more F-actin+ viable BMN in the biofilm of the candidalysin deficient mutants, compared to that of SC5314 (Fig 8A and 8C). Whereas, the two ECE1 revertant strains (ece1Δ/Δ+ECE1 [I] and ece1Δ/Δ+ECE1 [II]) showed comparable biofilms and NETotic induction activity to that of SC5314 (Fig 8). Treatment of exogenous candidalysin peptides to the C. albicans biofilms with BMN promoted BMN NETosis, decreased F-actin+ BMN, and abolished the resistance of all three candidalysin deficient mutants to BMN-mediated biofilm elimination (Fig 8). Together, expression of candidalysin by C. albicans induced NETosis and decreased persistence of C. albicans biofilm in the presence of neutrophils (Fig 9).
[Figure omitted. See PDF.]
Fig 8. Candidalysin induced NETosis of biofilm-infiltrating neutrophils and removal of Candida biofilms.
Bofilm formation assay of the reference strain SC5314, the candidalysin deficient isogenic mutants (ece1Δ/Δ, ece1Δ/Δ+ECE1Δ184–279 [I] and ece1Δ/Δ+ECE1Δ184–279 [II]), and the ECE1 revertant strains (ece1Δ/Δ+ECE1 [I] and ece1Δ/Δ+ECE1 [II]) was performed as described in Fig 7. (A) Representative images are shown. (B) Candida biofilms were quantified as the area of C. albicans cells (Fc-mDectin-1+) in each field on the coverslips. (C) Infiltration of BMNs (Ly6G+) into the surface-associated biofilms of each isolate is shown. (D and E) The percentage of NETotic BMNs (C-H3+ Ly6G+ cells/ total Ly6G+ cells) (D) and viable non- NETotic (F-actin+ C-H3- Ly6G+ cells/ total Ly6G+ cells) (E) in the biofilms is shown. All the images were analyzed with Imaris (Bitplane). (B-E) Results shown are mean with SD from 3 independent experiments, 2 images from each coverslip. Statistical analysis was performed with the one-way ANOVA, followed by Tukey’s multiple comparison test (B) or a two-tailed unpaired Student T test (C-E). **, P<0.01. ***, P<0.001. ****, P<0.0001. NS, no significant difference. Scale bar, 50 μm.
https://doi.org/10.1371/journal.ppat.1012319.g008
[Figure omitted. See PDF.]
Fig 9. A model for the function of candidalysin in inducing NETosis and C. albicans biofilm elimination in an intravascular catheter.
The biofilms of C. albicans clinical isolates exhibited different ability in promoting NETosis. Supplementation of candidalysin induced NETosis and facilitated C. albicans biofilm elimination Whereas, ablation of candidalysin expression in the high candidalysin-producing strain reduced NETosis and increased C. albicans persistence on a surface. Created with Biorender.com.
https://doi.org/10.1371/journal.ppat.1012319.g009
Discussion
C. albicans is one of the main pathogens causing intravascular catheter-related infections possibly due to its high biofilm formation capacity on the catheters [38]. In the present study, we characterized the biofilms on the intravascular catheters of candidiasis patients using multi-photon microscopy. We demonstrated the implication of NETosis in the interaction between C. albicans cells and patient immune system at the luminal surfaces of the catheters, suggesting a role of NETosis in shaping C. albicans colonization in an intravascular catheter. Accordingly, components of NETs, such as histone proteins and myeloperoxidase were found to be associated with C. albicans biofilms in a rat venous catheter infection model [43]. Using the in vitro biofilm formation model, we further showed that candidalysin can promote NETosis and fungal biofilm removal, highlighting that candidalysin downregulation by the clinical isolates enhances their surface colonization under TPN environment. Our findings may also, at least in part, explain why the gain-of-function ROB1946S allele, despite increasing in vitro biofilm formation and virulence expression, such as candidalysin overproduction, is very rare in C. albicans clinical isolates [23].
We identified biofilms comprising both fungal cells and host immune cells only at the luminal surfaces, but not at the outer surfaces, of the intravascular catheters removed from patients. Of note, while hyphal filaments are the main cell population in diverse in vitro studies [4,43–45], we only found Candida yeast cells and short filaments in the catheter-associated biofilms. The specific location of C. albicans biofilms at the luminal surface of an intravascular catheter from a patient was also seen in another previous study [7]. We thus proposed that the different environments between the inner luminal and outer surfaces of an intravascular catheter may underlie the tropism of C. albicans biofilm on the catheters. Accordingly, we showed that in the RPMI culture mimicking a blood environment suitable for immune cell growth, C. albicans exhibited filamentous structure and the biofilms were readily eliminated by neutrophils. Whereas, in TPN environment that can be found in the lumen of an intravascular catheter, filamentation of the catheter isolates was reduced and most of the isolates can resist neutrophil-mediated biofilm removal. The reduced filamentation and expression of filamentation associated virulence genes in C. albicans could be due to the fat emulsion of TPN, since these lipids were demonstrated to downregulate expression of HGC1 and UME6, both of which are positive regulators of C. albicans filamentation [14]. Of note, UME6 is downstream of Nrg1 regulation, explaining the comparable expression of NRG1 between RPMI and TPN environment in our finding [46]. In addition to the fat emulsion, the mild acidic environment in the TPN (pH = 6) may regulate the expression of PHR2, which is upregulated in acidic environment and controls C. albicans morphogenesis, cell wall structure, and virulence expression [47–49]. Accordingly, PHR2 expression was significantly increased in SC5314 when cultured in the TPN as compared to that in RPMI (S1C Fig, SC5314). The PHR2 upregulation in TPN culture environment was also observed in most of the catheter isolates, where the isolates of NTUH016 and NTUH042 were less responsive (S1C Fig). TPN culture environment may therefore exhibit pleiotropic effect on C. albicans, even in a strain-dependent manner. Besides, the effect of TPN environment on immune cell physiology is nevertheless unexplored and will be addressed in future studies.
Neutrophils are indispensable in controlling fungal infections. Neutrophil antimicrobial activity deficit, such as NADPH oxidase deficiency, results in impaired production of reactive oxygen species (ROS) of neutrophils and susceptibility to invasive candidiasis [50]. The ROS generated by neutrophil NADPH oxidase can induce NETosis followed by release of NETs and NLS, both of which are proinflammatory and exert antimicrobial activity [41]. We found NETs in the intravascular catheter of NTUH005 by H&E straining and two-photon microscopy with citH3 staining. However, C. albicans cells appeared to be associated to NLS with more compact structure than classical fibrous NETs induced by PMA activation [41]. The NLS was also found to be induced by filamentous C. albicans cells in a candidalysin-dependent manner [41,51]. Despite of the importance of neutrophils and NETosis in controlling C. albicans infection in humans, NETosis does not seem to be able to kill C. albicans, but to suppress or merely delay fungal growth in various in vitro models [16,41]. Our findings provide the evidence that NETosis can eliminate C. albicans biofilms, suggesting that neutrophil infiltration into intravascular catheters may contribute to dissociation of fungal cells, which might be captured by phagocytic cells that we could observe in the intravascular catheters removed from candidiasis patients. Future work will delineate the potential involvement of other immune cells together with neutrophils in controlling C. albicans infection in an intravascular catheter.
We observed NETosis and NLS in the catheter of NTUH001 and NTUH005. Accordingly, neutrophils specifically eliminated the biofilms formed by the corresponding isolates but not those of the other catheter isolates. The patients NTUH001 and NTUH005 did not present leukocytosis as compared to the other patients. These results suggest that the absence of NETosis and NLS in the catheters of NTUH016, NTUH019, NTUH037 and NTUH042 could be intrinsic to the property of C. albicans in the catheters. Despite of the NETosis induction capacity by NTUH001 and NTUH005 isolates, we showed that these two isolates exhibited low ECE1 expression similar to all the catheter isolates. Moreover, supplementation of candidalysin did not promote neutrophil-mediated biofilm removal against the two isolates. These results suggest that the two catheter isolates may induce NETosis in a candidalysin-independent manner. In addition to candidalysin, extracellular matrix of C. albicans biofilms was shown to induce NETosis [41,52]. Further studies will be performed to investigate the implication of biofilm matrix and other microbial factors in inducing NETosis by NTUH001 and NTUH005 isolates.
In summary, this study shows the implication of candidalysin in modulating NETosis and C. albicans persistence on the intravascular catheters. While NETosis can assist elimination of catheter-associated C. albicans biofilm, the NETs and NLS released by NETotic cells can result in adverse consequence on the host by inducing systemic inflammatory responses [53]. Accordingly, NTUH001 and NTUH005, the two patients showed NETosis in their catheters, died from the infection. Whereas, only 1 from the rest of the 4 patients died from the infection. A systemic cohort study will be required to elucidate the impact of NETosis in intravascular catheters on the consequence of intravascular catheter-related infections.
Materials and methods
Ethics statement
The study with a waiver of consent for medical record collection was approved by the Institutional Review Board of National Taiwan University Hospital (202008065RINA and 202112221RIND).
Subject
The catheter isolates were from six independent candidiasis patients with positive culture of C. albicans in the catheter culture between Aug. 2020 and Feb. 2021. The clinical information was retrospectively collected from medical records. All the patients were adults (> 18 yr old), and the clinical information is listed in Table 1.
Microbial culture
The clinical isolates used in this study were identified and confirmed by MALDI-TOF analysis. All the C. albicans strains were routinely cultivated in YPD (1% yeast extract, 2% peptone, and 2% glucose) at 28°C with shaking at 180 rpm. All the chemicals for the routine fungal culture were procured from Bionovas Biotechnology. For characterization of C. albicans cell morphology, overnight culture of C. albicans cells at 28°C in YPD was adjusted to the OD600 = 0.5, and cultured in complete RPMI culture media (RPMI [Simply Biologics] with 10% FBS [Biological Industries]) or the total parenteral nutrition Oliclinomel N4-550E Emulsion for Infusion (Baxter) at 37°C with shaking at 180 rpm.
Mutant construction
Strains with ECE1 (ece1Δ/Δ) gene deletion in C. albicans SC5314 were generated using the pSFS2A vector [54,55]. All of the primers used for vector construction were synthesized by MDbio Biotech Co, Inc (Taipei, Taiwan) and the sequences are available in Table 2. Briefly, the primer pairs ECE1AF/ECE1AR and ECE1BF/ECE1BR were used to respectively amplify the 5’- and 3’-flanking DNA fragments of the ECE1 gene by polymerase chain reaction (PCR). The amplified DNA fragments were cloned into pSFS2A by restriction enzymes ApaI/XhoI and NotI/SacI to generate the pSFS-ECE1KO vector. C. albicans SC5314 was transformed with the pSFS-ECE1KO, which was linearized by ApaI/SacI, to generate heterozygous ece1Δ/ECE1 strains. The SAT1 marker was recycled under treatment with 1% (wt/vol) maltose. The heterozygous strains (ece1Δ/ECE1) were retransformed with the linearized pSFS-ECE1KO to generate the homozygous ece1Δ/Δ strain. The ECE1 revertants were constructed as described below. ECE1 endogenous promoter and open reading frame (ORF) was amplified using the primer pair ECE1FLF/ECE1FLR. The resulting products were cloned into the pSFS2A by restriction enzymes ApaI/XhoI to generate the pSFS-ECE1 plasmid. The homozygous ece1Δ/Δ strain was transformed with the pSFS-ECE1 plasmid, which was linearized by HpaI, to generate the ECE1 revertant strains (SC5314 ece1Δ/Δ+ECE1). To generate candidalysin-deficient ECE1Δ184–279 strains, ECE1Δ184–279 was obtained by overlap elongation with the fragments amplified by the primer pairs ECE1FLF/ECE1D183-280OER and ECE1D280F/ECE1FLR. The DNA fragment of ECE1Δ184–279 was cloned into PCR-BluntII-TOPO (Thermo Fisher Scientific) for sequence confirmation, and subcloned into the pSFS2A by restriction enzymes ApaI/XhoI to generate the pSFS-ECE1Δ184–279 plasmid. The homozygous ece1Δ/Δ strain was transformed with the pSFS-ECE1Δ184–279 plasmid, which was linearized by HpaI, to generate the ECE1Δ184–279 revertant strains deficient in candidalysin peptide Ece1-III62-93 production (SC5314 ece1Δ/Δ+ECE1Δ184–279).
[Figure omitted. See PDF.]
Table 2. Primers used in this study.
https://doi.org/10.1371/journal.ppat.1012319.t002
Histochemistry staining
The catheters were fixed in 4% paraformaldehyde, cut into 5-mm long and embedded with Leica TP1020 Automated Benchtop Tissue Processor (Leica). After embedding, the tissues were sectioned into 10-μm thick slices (RM2125 RTS, Leica), and affixed onto slides. Hematoxylin and Eosin (H&E) staining and Periodic Acid-Schiff (PAS) staining were performed with the kits procured from CIS-biotechnology.
Fluorescence staining
The catheters were fixed in 4% paraformaldehyde, cut into 5-mm long, followed by incubation in the blocking buffer (0.4% Triton-X 100 with 1% BSA in PBS) for overnight at 4°C. For staining of fungal cells and fungal biofilms on coverslips in in vitro culture, the samples were fixed in 4% paraformaldehyde followed by incubation in the blocking buffer (0.4% Triton-X 100 with 1% BSA in PBS) for 1 hour at room temperature. The catheters and the cells were stained with the following antibodies and chemicals: BV421 mouse anti-human CD45 (1:100, 563879, BD Biosciences), rabbit anti-Candida (1:1000, ab53891, Abcam), rat anti-mouse Ly6G (1:500, 551459, BD Biosciences), hFc-mDectin-1a (1:1000, fc-mdec1a, Invivogen), Alexa Fluor 594 AffiniPure Goat Anti-Human IgG (H+L) (1:1000, Jackson ImmunoResearch), Calcofluor white (10μg/mL, BU-29067, Biotium), rhodamine-conjugated Concanavalin A (Con A) (1:500, RL-1002, Vector Laboratories), anti-rabbit antibody conjugated with Alexa Flour 594 (1:500, Invitrogen), Alexa Fluor 488 phalloidin (1:500, Invitrogen), and rabbit anti-Histone H3 (citrulline R2 + R8 + R17) (1:1000, ab5103, Abcam). The coverslips containing C. albicans biofilms were gently mounted using 10 uL of Fluoromount-G mounting medium (SouthernBiotech) before observation under a microscope.
Gene expression analysis
Overnight culture of C. albicans yeast cells at 28°C in YPD was adjusted to the OD600 0.5 and cultured in complete RPMI culture media (RPMI [Simply] with 10% FBS [Biological Industries]) or the total parenteral nutrition Oliclinomel N4-550E Emulsion for Infusion (Baxter) at 37°C with shaking at 180 rpm. Total RNA extraction of C. albicans cells was performed with the Monarch Total RNA Miniprep Kit (New England Biolabs). The concentration and purity of the extracted RNAs were determined using a Nanodrop 2000 spectrophotometer (Thermo Scientific). First-strand cDNA synthesis was conducted using the HiScript III TM First Strand cDNA Synthesis Kit (Bionovas Biotechnology), and the reaction was carried out in a MyCycler Thermal Cycler (Bio-Rad). The synthesized cDNAs were served as a template for quantitative PCR using the Luna Universal qPCR Master Mix kit (New England Biolabs) and the StepOnePlus Real-Time PCR system (Applied Biosystems by Life Technologies). The sequences of the primers for the gene expression quantification are listed in Table 2. The gene expression was quantified with the ΔCT method relative to the expression of ACT1 in each sample.
Mouse neutrophil isolation
Mouse neutrophils were isolated as described with modifications [56–58]. Mouse bone marrow cells were obtained from femurs and tibias of 7-week old C57BL/6 mice provided by National Laboratory Animal Center (NLAC), NARLabs, Taiwan. The procedure was approved by the Institutional Animal Care and Use Committee of National Yang Ming Chiao Tung University. The mouse bone marrow cells were resuspended in RPMI supplemented with Antibiotic-Antimycotic at 2x concentration (Simply Biologics). The cell suspension was then passed through a 40 μm mesh filter (BD Bioscienc), followed by incubation with RBC lysis buffer (Invitrogen) to lyse the red blood cells. Next, the residual living cells were suspended in 45% Percoll solution (Cytiva Percoll PLUS Centrifugation Media). Percoll gradients were prepared by layering 2 mL each of the 52 and 62% Percoll solutions on top of 3 mL of 81% Percoll solution in a conical 15-mL centrifuge tube. The bone marrow cell suspension was slowly applied to the top to the Percoll gradients and centrifuged at 1000 ×g for 30 minutes with no brake at 25°C. The cells located in the layer 3 (between 62% and 81% Percoll) within the Percoll gradient were collected and washed with HBSS (Invitrogen). Cell viability was validated by trypan blue (Invitrogen) and propidium iodide (PI) (Invitrogen) staining. Mouse Ly6G staining (rat anti-mouse Ly6G, 551459, BD Biosciences) was performed to validate the purity of the isolated neutrophils.
Biofilm formation assay
Overnight culture of C. albicans yeast cells at 28°C in YPD was adjusted to the OD600 0.5 and resuspended in complete RPMI culture media (RPMI [Simply Biologics] with 10% FBS [Biological Industries]) or the total parenteral nutrition Oliclinomel N4-550E Emulsion for Infusion (Baxter). The cells were cultured in a 24-well cell culture plate, in which each well contained a coverslip pre-coated with 1% FBS. The culture was incubated at 37°C for 24 hours without shaking to develop mature biofilms, followed by removal of unbound fungal cells by three times of PBS wash. The effect of neutrophils and candidalysin on C. albicans biofilms was performed by adding 2 x 105 mouse bone marrow neutrophils and 15 μM of candidalysin peptide (Ece1-III62-93, SIIGGIIMGILGNIPQVIQIIMSIVKAFKGNKR, synthesized by Genomics, Taiwan, purity 95.21%) to the mature biofilms in the culture environment as indicated for another 6 hours at 37°C [20]. The coverslips were then washed with PBS followed by fixation with 4% paraformaldehyde and staining.
Image analyses
The images of the unstained catheters, the fungal cells in different culture media, and the biofilms on the coverslips were captured using a Zeiss Axio Observer 7 fluorescence microscope. The images of H&E or PAS stained samples were captured using an Olympus BX63 microscope and processed by the Olyvia (Ver. 2.9, Olympus Life Science). The two-photon images were obtained by a Zeiss LSM 7MP multiphoton microscope and processed by ZEN (blue edition, Ver. 3.0, Zeiss). The 3D images of the catheters were reconstituted by Imaris (Bitplane). The volume of citrullinated Histone H3 in catheters was quantified by measuring the relative volume of anti-citH3+ signals in individual stacked images (327 μm ⊆ 327 μm ⊆ 80 μm for each stack) and analyzed with Imaris (Bitplane).
Statistical analysis
All data analyses were performed using Prism V8 (GraphPad). Statistics was carried out using the two-tailed unpaired Student T test, or the one-way ANOVA test followed by Tukey’s multiple comparison test or Dunnett’s multiple comparison test.
Supporting information
S1 Fig. Expression of ALS3, HGC1 and PHR2 in the C. albicans catheter isolates cultured in RPMI and TPN.
C. albicans yeast cells were cultured in RPMI (A) or TPN (B) at 37°C for 24 hours. Gene expression was quantified by qRT-PCR and normalized to ACT1 expression. Data represent mean with SD from two independent experiments. Statistical analysis was performed with the one-way ANOVA, followed by Dunnett’s multiple comparison test as compared to the reference strain SC5314 (A and B) or a Student T test (C). *, P<0.05. **, P<0.01. NS, no significant difference.
https://doi.org/10.1371/journal.ppat.1012319.s001
(PDF)
S2 Fig. Diverse biofilm properties of the catheter isolates and the interaction of fungal biofilms with mouse neutrophils in RPMI.
C. albicans cells were cultured in RPMI for 24 hours to allow biofilm formation on a coverslip. The biofilms developed in RPMI were then incubated with mouse bone marrow-derived neutrophils (BMN) in RPMI in the absence or presence of candidalysin (CaL, 15 μM) for another 6 hours before fixation and staining. BMN NETosis was observed by Ly6G (cyan), F-actin (white) and citrullinated histone H3 staining (C-H3, red). Candida cells were stained by mDectin-1-Fc (green) that recognizes β-glucan on fungal cell wall. (A) Representative images are shown. (B) Candida biofilms were quantified as the area of C. albicans cells in each field on the coverslips. (C) The percentage of NETotic BMNs (C-H3+ Ly6G+ cells/ total Ly6G+ cells) in the biofilms is shown. All the images were analyzed with Imaris (Bitplane). (B-C) Results shown are mean with SD from 3 independent experiments, 2 images from each coverslip. Statistical analysis was performed with one-way ANOVA, followed by a Tukey’s multiple comparison test (B) or a Student T test (C). *, P<0.05. **, P<0.01. ***, P<0.001. ****, P<0.0001. NS, no significant difference. Scale bar, 50 μm.
https://doi.org/10.1371/journal.ppat.1012319.s002
(PDF)
S1 Data. Excel spreadsheet containing, in separate sheets, the underlying numerical data for Figs 4B, 6A, 6B, 7B, 7C, 7D, 7E, 8B, 8C, 8D, 8E, S1A, S1B, S1C, S2B and S2C.
https://doi.org/10.1371/journal.ppat.1012319.s003
(XLSX)
Acknowledgments
We thank for technical assistance of Microscopy Core Laboratory, Chang Gung Memorial Hospital, Linkou. We would also like to acknowledge the assistance of Imaging Core Facility of National Yang Ming Chiao Tung University for the service of Zeiss LSM 7 MP Multi-Photon Microscope and Zeiss LSM700 confocal microscope, especially Ms. Pei-jun Chen and Yung-yu Lu for their technical support.
References
1. 1. Kullberg BJ, Arendrup MC. Invasive Candidiasis. N Engl J Med. 2015;373(15):1445–56. Epub 2015/10/09. pmid:26444731.
* View Article
* PubMed/NCBI
* Google Scholar
2. 2. Donlan RM, Costerton JW. Biofilms: survival mechanisms of clinically relevant microorganisms. Clin Microbiol Rev. 2002;15(2):167–93. Epub 2002/04/05. pmid:11932229; PubMed Central PMCID: PMC118068.
* View Article
* PubMed/NCBI
* Google Scholar
3. 3. Kolter R. Biofilms in lab and nature: a molecular geneticist’s voyage to microbial ecology. Int Microbiol. 2010;13(1):1–7. Epub 2010/10/05. pmid:20890834.
* View Article
* PubMed/NCBI
* Google Scholar
4. 4. Nobile CJ, Johnson AD. Candida albicans Biofilms and Human Disease. Annu Rev Microbiol. 2015;69:71–92. Epub 2015/10/22. pmid:26488273; PubMed Central PMCID: PMC4930275.
* View Article
* PubMed/NCBI
* Google Scholar
5. 5. Dominic RM, Shenoy S, Baliga S. Candida biofilms in medical devices: evolving trends. Kathmandu Univ Med J (KUMJ). 2007;5(3):431–6. Epub 2008/07/08. pmid:18604070.
* View Article
* PubMed/NCBI
* Google Scholar
6. 6. Dongari-Bagtzoglou A, Kashleva H, Dwivedi P, Diaz P, Vasilakos J. Characterization of mucosal Candida albicans biofilms. PLoS One. 2009;4(11):e7967. Epub 2009/12/04. pmid:19956771; PubMed Central PMCID: PMC2776351.
* View Article
* PubMed/NCBI
* Google Scholar
7. 7. Seddiki SM, Boucherit-Otmani Z, Boucherit K, Badsi-Amir S, Taleb M, Kunkel D. Assessment of the types of catheter infectivity caused by Candida species and their biofilm formation. First study in an intensive care unit in Algeria. Int J Gen Med. 2013;6:1–7. Epub 2013/01/25. pmid:23345986; PubMed Central PMCID: PMC3549679.
* View Article
* PubMed/NCBI
* Google Scholar
8. 8. Andes DR, Safdar N, Baddley JW, Playford G, Reboli AC, Rex JH, et al. Impact of treatment strategy on outcomes in patients with candidemia and other forms of invasive candidiasis: a patient-level quantitative review of randomized trials. Clin Infect Dis. 2012;54(8):1110–22. Epub 2012/03/14. pmid:22412055.
* View Article
* PubMed/NCBI
* Google Scholar
9. 9. Lortholary O, Petrikkos G, Akova M, Arendrup MC, Arikan-Akdagli S, Bassetti M, et al. ESCMID* guideline for the diagnosis and management of Candida diseases 2012: patients with HIV infection or AIDS. Clin Microbiol Infect. 2012;18 Suppl 7:68–77. Epub 2013/01/04. pmid:23137138.
* View Article
* PubMed/NCBI
* Google Scholar
10. 10. Mermel LA, Allon M, Bouza E, Craven DE, Flynn P, O’Grady NP, et al. Clinical practice guidelines for the diagnosis and management of intravascular catheter-related infection: 2009 Update by the Infectious Diseases Society of America. Clin Infect Dis. 2009;49(1):1–45. Epub 2009/06/06. pmid:19489710; PubMed Central PMCID: PMC4039170.
* View Article
* PubMed/NCBI
* Google Scholar
11. 11. Kojic EM, Darouiche RO. Candida infections of medical devices. Clin Microbiol Rev. 2004;17(2):255–67. Epub 2004/04/16. pmid:15084500; PubMed Central PMCID: PMC387407.
* View Article
* PubMed/NCBI
* Google Scholar
12. 12. Swindell K, Lattif AA, Chandra J, Mukherjee PK, Ghannoum MA. Parenteral lipid emulsion induces germination of Candida albicans and increases biofilm formation on medical catheter surfaces. J Infect Dis. 2009;200(3):473–80. Epub 2009/06/26. pmid:19552524.
* View Article
* PubMed/NCBI
* Google Scholar
13. 13. Barker KS, Liu T, Rogers PD. Coculture of THP-1 human mononuclear cells with Candida albicans results in pronounced changes in host gene expression. J Infect Dis. 2005;192(5):901–12. Epub 2005/08/10. pmid:16088841.
* View Article
* PubMed/NCBI
* Google Scholar
14. 14. Alvira-Arill GR, Willems HME, Fortwendel JP, Yarbrough A, Tansmore J, Sierra CM, et al. Impact of intravenous fat emulsion choice on Candida biofilm, hyphal growth, and catheter-related bloodstream infections in pediatric patients. J Infect Dis. 2023. Epub 2023/11/25. pmid:38001054.
* View Article
* PubMed/NCBI
* Google Scholar
15. 15. Katragkou A, Kruhlak MJ, Simitsopoulou M, Chatzimoschou A, Taparkou A, Cotten CJ, et al. Interactions between human phagocytes and Candida albicans biofilms alone and in combination with antifungal agents. J Infect Dis. 2010;201(12):1941–9. Epub 2010/04/27. pmid:20415537; PubMed Central PMCID: PMC2911126.
* View Article
* PubMed/NCBI
* Google Scholar
16. 16. Hopke A, Scherer A, Kreuzburg S, Abers MS, Zerbe CS, Dinauer MC, et al. Neutrophil swarming delays the growth of clusters of pathogenic fungi. Nat Commun. 2020;11(1):2031. Epub 2020/04/29. pmid:32341348; PubMed Central PMCID: PMC7184738.
* View Article
* PubMed/NCBI
* Google Scholar
17. 17. El Kasmi KC, Anderson AL, Devereaux MW, Vue PM, Zhang W, Setchell KD, et al. Phytosterols promote liver injury and Kupffer cell activation in parenteral nutrition-associated liver disease. Sci Transl Med. 2013;5(206):206ra137. Epub 2013/10/11. pmid:24107776; PubMed Central PMCID: PMC4070735.
* View Article
* PubMed/NCBI
* Google Scholar
18. 18. Hubbard MJ, Markie D, Poulter RT. Isolation and morphological characterization of a mycelial mutant of Candida albicans. Journal of bacteriology. 1986;165(1):61–5. pmid:3510192; PubMed Central PMCID: PMC214370.
* View Article
* PubMed/NCBI
* Google Scholar
19. 19. Carlisle PL, Kadosh D. A genome-wide transcriptional analysis of morphology determination in Candida albicans. Molecular biology of the cell. 2013;24(3):246–60. pmid:23242994; PubMed Central PMCID: PMC3564527.
* View Article
* PubMed/NCBI
* Google Scholar
20. 20. Moyes DL, Wilson D, Richardson JP, Mogavero S, Tang SX, Wernecke J, et al. Candidalysin is a fungal peptide toxin critical for mucosal infection. Nature. 2016;532(7597):64–8. Epub 2016/03/31. pmid:27027296; PubMed Central PMCID: PMC4851236.
* View Article
* PubMed/NCBI
* Google Scholar
21. 21. Lo HJ, Kohler JR, DiDomenico B, Loebenberg D, Cacciapuoti A, Fink GR. Nonfilamentous C. albicans mutants are avirulent. Cell. 1997;90(5):939–49. Epub 1997/09/23. pmid:9298905.
* View Article
* PubMed/NCBI
* Google Scholar
22. 22. Vautier S, Drummond RA, Chen K, Murray GI, Kadosh D, Brown AJ, et al. Candida albicans colonization and dissemination from the murine gastrointestinal tract: the influence of morphology and Th17 immunity. Cell Microbiol. 2015;17(4):445–50. Epub 2014/10/28. pmid:25346172; PubMed Central PMCID: PMC4409086.
* View Article
* PubMed/NCBI
* Google Scholar
23. 23. Glazier VE, Kramara J, Ollinger T, Solis NV, Zarnowski R, Wakade RS, et al. The Candida albicans reference strain SC5314 contains a rare, dominant allele of the transcription factor Rob1 that modulates filamentation, biofilm formation, and oral commensalism. mBio. 2023;14(5):e0152123. Epub 2023/09/22. pmid:37737633; PubMed Central PMCID: PMC10653842.
* View Article
* PubMed/NCBI
* Google Scholar
24. 24. Hawser SP, Douglas LJ. Biofilm formation by Candida species on the surface of catheter materials in vitro. Infect Immun. 1994;62(3):915–21. Epub 1994/03/01. pmid:8112864; PubMed Central PMCID: PMC186203.
* View Article
* PubMed/NCBI
* Google Scholar
25. 25. Honraet K, Goetghebeur E, Nelis HJ. Comparison of three assays for the quantification of Candida biomass in suspension and CDC reactor grown biofilms. J Microbiol Methods. 2005;63(3):287–95. Epub 2005/06/07. pmid:15936097.
* View Article
* PubMed/NCBI
* Google Scholar
26. 26. Klotz SA, Drutz DJ, Zajic JE. Factors governing adherence of Candida species to plastic surfaces. Infect Immun. 1985;50(1):97–101. Epub 1985/10/01. pmid:3899942; PubMed Central PMCID: PMC262141.
* View Article
* PubMed/NCBI
* Google Scholar
27. 27. Nikawa H, Nishimura H, Hamada T, Kumagai H, Samaranayake LP. Effects of dietary sugars and, saliva and serum on Candida bioflim formation on acrylic surfaces. Mycopathologia. 1997;139(2):87–91. Epub 1997/01/01. pmid:9549102.
* View Article
* PubMed/NCBI
* Google Scholar
28. 28. Uppuluri P, Chaturvedi AK, Srinivasan A, Banerjee M, Ramasubramaniam AK, Kohler JR, et al. Dispersion as an important step in the Candida albicans biofilm developmental cycle. PLoS Pathog. 2010;6(3):e1000828. Epub 2010/04/03. pmid:20360962; PubMed Central PMCID: PMC2847914.
* View Article
* PubMed/NCBI
* Google Scholar
29. 29. Finkel JS, Xu W, Huang D, Hill EM, Desai JV, Woolford CA, et al. Portrait of Candida albicans adherence regulators. PLoS Pathog. 2012;8(2):e1002525. Epub 2012/02/24. pmid:22359502; PubMed Central PMCID: PMC3280983.
* View Article
* PubMed/NCBI
* Google Scholar
30. 30. Hasan F, Xess I, Wang X, Jain N, Fries BC. Biofilm formation in clinical Candida isolates and its association with virulence. Microbes Infect. 2009;11(8–9):753–61. Epub 2009/05/05. pmid:19409507; PubMed Central PMCID: PMC2715444.
* View Article
* PubMed/NCBI
* Google Scholar
31. 31. Munoz M, Wintaco LM, Munoz SA, Ramirez JD. Dissecting the Heterogeneous Population Genetic Structure of Candida albicans: Limitations and Constraints of the Multilocus Sequence Typing Scheme. Front Microbiol. 2019;10:1052. Epub 2019/05/28. pmid:31134042; PubMed Central PMCID: PMC6524206.
* View Article
* PubMed/NCBI
* Google Scholar
32. 32. Marak MB, Dhanashree B. Antifungal Susceptibility and Biofilm Production of Candida spp. Isolated from Clinical Samples. Int J Microbiol. 2018;2018:7495218. Epub 2018/11/09. pmid:30405717; PubMed Central PMCID: PMC6199855.
* View Article
* PubMed/NCBI
* Google Scholar
33. 33. Thiam HR, Wong SL, Qiu R, Kittisopikul M, Vahabikashi A, Goldman AE, et al. NETosis proceeds by cytoskeleton and endomembrane disassembly and PAD4-mediated chromatin decondensation and nuclear envelope rupture. Proc Natl Acad Sci U S A. 2020;117(13):7326–37. Epub 2020/03/15. pmid:32170015; PubMed Central PMCID: PMC7132277.
* View Article
* PubMed/NCBI
* Google Scholar
34. 34. Thiam HR, Wong SL, Qiu R, Kittisopikul M, Vahabikashi A, Goldman AE, et al. Reply to Liu: The disassembly of the actin cytoskeleton is an early event during NETosis. Proc Natl Acad Sci U S A. 2020;117(37):22655–6. Epub 2020/09/19. pmid:32943583; PubMed Central PMCID: PMC7502743.
* View Article
* PubMed/NCBI
* Google Scholar
35. 35. Tilley DO, Abuabed U, Zimny Arndt U, Schmid M, Florian S, Jungblut PR, et al. Histone H3 clipping is a novel signature of human neutrophil extracellular traps. Elife. 2022;11. Epub 2022/10/26. pmid:36282064; PubMed Central PMCID: PMC9665850.
* View Article
* PubMed/NCBI
* Google Scholar
36. 36. Shankar M, Lo TL, Traven A. Natural Variation in Clinical Isolates of Candida albicans Modulates Neutrophil Responses. mSphere. 2020;5(4). Epub 2020/08/21. pmid:32817378; PubMed Central PMCID: PMC7440844.
* View Article
* PubMed/NCBI
* Google Scholar
37. 37. Kucharikova S, Tournu H, Lagrou K, Van Dijck P, Bujdakova H. Detailed comparison of Candida albicans and Candida glabrata biofilms under different conditions and their susceptibility to caspofungin and anidulafungin. J Med Microbiol. 2011;60(Pt 9):1261–9. Epub 2011/05/14. pmid:21566087.
* View Article
* PubMed/NCBI
* Google Scholar
38. 38. Chow JK, Golan Y, Ruthazer R, Karchmer AW, Carmeli Y, Lichtenberg D, et al. Factors associated with candidemia caused by non-albicans Candida species versus Candida albicans in the intensive care unit. Clin Infect Dis. 2008;46(8):1206–13. Epub 2008/05/01. pmid:18444857.
* View Article
* PubMed/NCBI
* Google Scholar
39. 39. Luzzati R, Cavinato S, Giangreco M, Grana G, Centonze S, Deiana ML, et al. Peripheral and total parenteral nutrition as the strongest risk factors for nosocomial candidemia in elderly patients: a matched case-control study. Mycoses. 2013;56(6):664–71. Epub 2013/05/17. pmid:23675641.
* View Article
* PubMed/NCBI
* Google Scholar
40. 40. Wakade RS, Ristow LC, Wellington M, Krysan DJ. Intravital imaging-based genetic screen reveals the transcriptional network governing Candida albicans filamentation during mammalian infection. Elife. 2023;12. Epub 2023/02/28. pmid:36847358; PubMed Central PMCID: PMC9995110.
* View Article
* PubMed/NCBI
* Google Scholar
41. 41. Unger L, Skoluda S, Backman E, Amulic B, Ponce-Garcia FM, Etiaba CN, et al. Candida albicans induces neutrophil extracellular traps and leucotoxic hypercitrullination via candidalysin. EMBO Rep. 2023;24(11):e57571. Epub 2023/10/05. pmid:37795769; PubMed Central PMCID: PMC10626426.
* View Article
* PubMed/NCBI
* Google Scholar
42. 42. Cravener MV, Do E, May G, Zarnowski R, Andes DR, McManus CJ, et al. Reinforcement amid genetic diversity in the Candida albicans biofilm regulatory network. PLoS Pathog. 2023;19(1):e1011109. Epub 2023/01/26. pmid:36696432; PubMed Central PMCID: PMC9901766.
* View Article
* PubMed/NCBI
* Google Scholar
43. 43. Nett JE, Zarnowski R, Cabezas-Olcoz J, Brooks EG, Bernhardt J, Marchillo K, et al. Host contributions to construction of three device-associated Candida albicans biofilms. Infect Immun. 2015;83(12):4630–8. Epub 2015/09/16. pmid:26371129; PubMed Central PMCID: PMC4645408.
* View Article
* PubMed/NCBI
* Google Scholar
44. 44. Nett J, Lincoln L, Marchillo K, Massey R, Holoyda K, Hoff B, et al. Putative role of beta-1,3 glucans in Candida albicans biofilm resistance. Antimicrob Agents Chemother. 2007;51(2):510–20. Epub 2006/11/30. pmid:17130296; PubMed Central PMCID: PMC1797745.
* View Article
* PubMed/NCBI
* Google Scholar
45. 45. Kavanaugh NL, Zhang AQ, Nobile CJ, Johnson AD, Ribbeck K. Mucins suppress virulence traits of Candida albicans. MBio. 2014;5(6):e01911. Epub 2014/11/13. pmid:25389175; PubMed Central PMCID: PMC4235211.
* View Article
* PubMed/NCBI
* Google Scholar
46. 46. Banerjee M, Thompson DS, Lazzell A, Carlisle PL, Pierce C, Monteagudo C, et al. UME6, a novel filament-specific regulator of Candida albicans hyphal extension and virulence. Mol Biol Cell. 2008;19(4):1354–65. Epub 2008/01/25. pmid:18216277; PubMed Central PMCID: PMC2291399.
* View Article
* PubMed/NCBI
* Google Scholar
47. 47. Muhlschlegel FA, Fonzi WA. PHR2 of Candida albicans encodes a functional homolog of the pH-regulated gene PHR1 with an inverted pattern of pH-dependent expression. Mol Cell Biol. 1997;17(10):5960–7. Epub 1997/10/07. pmid:9315654; PubMed Central PMCID: PMC232444.
* View Article
* PubMed/NCBI
* Google Scholar
48. 48. De Bernardis F, Muhlschlegel FA, Cassone A, Fonzi WA. The pH of the host niche controls gene expression in and virulence of Candida albicans. Infect Immun. 1998;66(7):3317–25. Epub 1998/06/25. pmid:9632601; PubMed Central PMCID: PMC108348.
* View Article
* PubMed/NCBI
* Google Scholar
49. 49. Fonzi WA. PHR1 and PHR2 of Candida albicans encode putative glycosidases required for proper cross-linking of beta-1,3- and beta-1,6-glucans. J Bacteriol. 1999;181(22):7070–9. Epub 1999/11/13. pmid:10559174; PubMed Central PMCID: PMC94183.
* View Article
* PubMed/NCBI
* Google Scholar
50. 50. Lionakis MS, Drummond RA, Hohl TM. Immune responses to human fungal pathogens and therapeutic prospects. Nat Rev Immunol. 2023;23(7):433–52. Epub 2023/01/05. pmid:36600071; PubMed Central PMCID: PMC9812358 2020. The other authors declare no competing interests.
* View Article
* PubMed/NCBI
* Google Scholar
51. 51. Branzk N, Lubojemska A, Hardison SE, Wang Q, Gutierrez MG, Brown GD, et al. Neutrophils sense microbe size and selectively release neutrophil extracellular traps in response to large pathogens. Nat Immunol. 2014;15(11):1017–25. Epub 2014/09/15. pmid:25217981; PubMed Central PMCID: PMC4236687.
* View Article
* PubMed/NCBI
* Google Scholar
52. 52. Smolarz M, Zawrotniak M, Satala D, Rapala-Kozik M. Extracellular Nucleic Acids Present in the Candida albicans Biofilm Trigger the Release of Neutrophil Extracellular Traps. Front Cell Infect Microbiol. 2021;11:681030. Epub 2021/06/15. pmid:34123878; PubMed Central PMCID: PMC8187917.
* View Article
* PubMed/NCBI
* Google Scholar
53. 53. Margraf A, Lowell CA, Zarbock A. Neutrophils in acute inflammation: current concepts and translational implications. Blood. 2022;139(14):2130–44. Epub 2021/10/09. pmid:34624098; PubMed Central PMCID: PMC9728535.
* View Article
* PubMed/NCBI
* Google Scholar
54. 54. Bennett RJ, Johnson AD. The role of nutrient regulation and the Gpa2 protein in the mating pheromone response of C. albicans. Mol Microbiol. 2006;62(1):100–19. pmid:16987174.
* View Article
* PubMed/NCBI
* Google Scholar
55. 55. Reuss O, Vik A, Kolter R, Morschhauser J. The SAT1 flipper, an optimized tool for gene disruption in Candida albicans. Gene. 2004;341:119–27. Epub 2004/10/12. pmid:15474295.
* View Article
* PubMed/NCBI
* Google Scholar
56. 56. Sung PS, Huang TF, Hsieh SL. Extracellular vesicles from CLEC2-activated platelets enhance dengue virus-induced lethality via CLEC5A/TLR2. Nature communications. 2019;10(1):2402. pmid:31160588; PubMed Central PMCID: PMC6546763.
* View Article
* PubMed/NCBI
* Google Scholar
57. 57. Chen ST, Li FJ, Hsu TY, Liang SM, Yeh YC, Liao WY, et al. CLEC5A is a critical receptor in innate immunity against Listeria infection. Nature communications. 2017;8(1):299. pmid:28824166; PubMed Central PMCID: PMC5563510.
* View Article
* PubMed/NCBI
* Google Scholar
58. 58. Lammermann T, Afonso PV, Angermann BR, Wang JM, Kastenmuller W, Parent CA, et al. Neutrophil swarms require LTB4 and integrins at sites of cell death in vivo. Nature. 2013;498(7454):371–5. pmid:23708969; PubMed Central PMCID: PMC3879961.
* View Article
* PubMed/NCBI
* Google Scholar
Citation: Tseng K-Y, Huang Y-T, Huang Y-T, Su Y-T, Wang A-N, Weng W-Y, et al. (2024) Regulation of candidalysin underlies Candida albicans persistence in intravascular catheters by modulating NETosis. PLoS Pathog 20(6): e1012319. https://doi.org/10.1371/journal.ppat.1012319
1. Kullberg BJ, Arendrup MC. Invasive Candidiasis. N Engl J Med. 2015;373(15):1445–56. Epub 2015/10/09. pmid:26444731.
2. Donlan RM, Costerton JW. Biofilms: survival mechanisms of clinically relevant microorganisms. Clin Microbiol Rev. 2002;15(2):167–93. Epub 2002/04/05. pmid:11932229; PubMed Central PMCID: PMC118068.
3. Kolter R. Biofilms in lab and nature: a molecular geneticist’s voyage to microbial ecology. Int Microbiol. 2010;13(1):1–7. Epub 2010/10/05. pmid:20890834.
4. Nobile CJ, Johnson AD. Candida albicans Biofilms and Human Disease. Annu Rev Microbiol. 2015;69:71–92. Epub 2015/10/22. pmid:26488273; PubMed Central PMCID: PMC4930275.
5. Dominic RM, Shenoy S, Baliga S. Candida biofilms in medical devices: evolving trends. Kathmandu Univ Med J (KUMJ). 2007;5(3):431–6. Epub 2008/07/08. pmid:18604070.
6. Dongari-Bagtzoglou A, Kashleva H, Dwivedi P, Diaz P, Vasilakos J. Characterization of mucosal Candida albicans biofilms. PLoS One. 2009;4(11):e7967. Epub 2009/12/04. pmid:19956771; PubMed Central PMCID: PMC2776351.
7. Seddiki SM, Boucherit-Otmani Z, Boucherit K, Badsi-Amir S, Taleb M, Kunkel D. Assessment of the types of catheter infectivity caused by Candida species and their biofilm formation. First study in an intensive care unit in Algeria. Int J Gen Med. 2013;6:1–7. Epub 2013/01/25. pmid:23345986; PubMed Central PMCID: PMC3549679.
8. Andes DR, Safdar N, Baddley JW, Playford G, Reboli AC, Rex JH, et al. Impact of treatment strategy on outcomes in patients with candidemia and other forms of invasive candidiasis: a patient-level quantitative review of randomized trials. Clin Infect Dis. 2012;54(8):1110–22. Epub 2012/03/14. pmid:22412055.
9. Lortholary O, Petrikkos G, Akova M, Arendrup MC, Arikan-Akdagli S, Bassetti M, et al. ESCMID* guideline for the diagnosis and management of Candida diseases 2012: patients with HIV infection or AIDS. Clin Microbiol Infect. 2012;18 Suppl 7:68–77. Epub 2013/01/04. pmid:23137138.
10. Mermel LA, Allon M, Bouza E, Craven DE, Flynn P, O’Grady NP, et al. Clinical practice guidelines for the diagnosis and management of intravascular catheter-related infection: 2009 Update by the Infectious Diseases Society of America. Clin Infect Dis. 2009;49(1):1–45. Epub 2009/06/06. pmid:19489710; PubMed Central PMCID: PMC4039170.
11. Kojic EM, Darouiche RO. Candida infections of medical devices. Clin Microbiol Rev. 2004;17(2):255–67. Epub 2004/04/16. pmid:15084500; PubMed Central PMCID: PMC387407.
12. Swindell K, Lattif AA, Chandra J, Mukherjee PK, Ghannoum MA. Parenteral lipid emulsion induces germination of Candida albicans and increases biofilm formation on medical catheter surfaces. J Infect Dis. 2009;200(3):473–80. Epub 2009/06/26. pmid:19552524.
13. Barker KS, Liu T, Rogers PD. Coculture of THP-1 human mononuclear cells with Candida albicans results in pronounced changes in host gene expression. J Infect Dis. 2005;192(5):901–12. Epub 2005/08/10. pmid:16088841.
14. Alvira-Arill GR, Willems HME, Fortwendel JP, Yarbrough A, Tansmore J, Sierra CM, et al. Impact of intravenous fat emulsion choice on Candida biofilm, hyphal growth, and catheter-related bloodstream infections in pediatric patients. J Infect Dis. 2023. Epub 2023/11/25. pmid:38001054.
15. Katragkou A, Kruhlak MJ, Simitsopoulou M, Chatzimoschou A, Taparkou A, Cotten CJ, et al. Interactions between human phagocytes and Candida albicans biofilms alone and in combination with antifungal agents. J Infect Dis. 2010;201(12):1941–9. Epub 2010/04/27. pmid:20415537; PubMed Central PMCID: PMC2911126.
16. Hopke A, Scherer A, Kreuzburg S, Abers MS, Zerbe CS, Dinauer MC, et al. Neutrophil swarming delays the growth of clusters of pathogenic fungi. Nat Commun. 2020;11(1):2031. Epub 2020/04/29. pmid:32341348; PubMed Central PMCID: PMC7184738.
17. El Kasmi KC, Anderson AL, Devereaux MW, Vue PM, Zhang W, Setchell KD, et al. Phytosterols promote liver injury and Kupffer cell activation in parenteral nutrition-associated liver disease. Sci Transl Med. 2013;5(206):206ra137. Epub 2013/10/11. pmid:24107776; PubMed Central PMCID: PMC4070735.
18. Hubbard MJ, Markie D, Poulter RT. Isolation and morphological characterization of a mycelial mutant of Candida albicans. Journal of bacteriology. 1986;165(1):61–5. pmid:3510192; PubMed Central PMCID: PMC214370.
19. Carlisle PL, Kadosh D. A genome-wide transcriptional analysis of morphology determination in Candida albicans. Molecular biology of the cell. 2013;24(3):246–60. pmid:23242994; PubMed Central PMCID: PMC3564527.
20. Moyes DL, Wilson D, Richardson JP, Mogavero S, Tang SX, Wernecke J, et al. Candidalysin is a fungal peptide toxin critical for mucosal infection. Nature. 2016;532(7597):64–8. Epub 2016/03/31. pmid:27027296; PubMed Central PMCID: PMC4851236.
21. Lo HJ, Kohler JR, DiDomenico B, Loebenberg D, Cacciapuoti A, Fink GR. Nonfilamentous C. albicans mutants are avirulent. Cell. 1997;90(5):939–49. Epub 1997/09/23. pmid:9298905.
22. Vautier S, Drummond RA, Chen K, Murray GI, Kadosh D, Brown AJ, et al. Candida albicans colonization and dissemination from the murine gastrointestinal tract: the influence of morphology and Th17 immunity. Cell Microbiol. 2015;17(4):445–50. Epub 2014/10/28. pmid:25346172; PubMed Central PMCID: PMC4409086.
23. Glazier VE, Kramara J, Ollinger T, Solis NV, Zarnowski R, Wakade RS, et al. The Candida albicans reference strain SC5314 contains a rare, dominant allele of the transcription factor Rob1 that modulates filamentation, biofilm formation, and oral commensalism. mBio. 2023;14(5):e0152123. Epub 2023/09/22. pmid:37737633; PubMed Central PMCID: PMC10653842.
24. Hawser SP, Douglas LJ. Biofilm formation by Candida species on the surface of catheter materials in vitro. Infect Immun. 1994;62(3):915–21. Epub 1994/03/01. pmid:8112864; PubMed Central PMCID: PMC186203.
25. Honraet K, Goetghebeur E, Nelis HJ. Comparison of three assays for the quantification of Candida biomass in suspension and CDC reactor grown biofilms. J Microbiol Methods. 2005;63(3):287–95. Epub 2005/06/07. pmid:15936097.
26. Klotz SA, Drutz DJ, Zajic JE. Factors governing adherence of Candida species to plastic surfaces. Infect Immun. 1985;50(1):97–101. Epub 1985/10/01. pmid:3899942; PubMed Central PMCID: PMC262141.
27. Nikawa H, Nishimura H, Hamada T, Kumagai H, Samaranayake LP. Effects of dietary sugars and, saliva and serum on Candida bioflim formation on acrylic surfaces. Mycopathologia. 1997;139(2):87–91. Epub 1997/01/01. pmid:9549102.
28. Uppuluri P, Chaturvedi AK, Srinivasan A, Banerjee M, Ramasubramaniam AK, Kohler JR, et al. Dispersion as an important step in the Candida albicans biofilm developmental cycle. PLoS Pathog. 2010;6(3):e1000828. Epub 2010/04/03. pmid:20360962; PubMed Central PMCID: PMC2847914.
29. Finkel JS, Xu W, Huang D, Hill EM, Desai JV, Woolford CA, et al. Portrait of Candida albicans adherence regulators. PLoS Pathog. 2012;8(2):e1002525. Epub 2012/02/24. pmid:22359502; PubMed Central PMCID: PMC3280983.
30. Hasan F, Xess I, Wang X, Jain N, Fries BC. Biofilm formation in clinical Candida isolates and its association with virulence. Microbes Infect. 2009;11(8–9):753–61. Epub 2009/05/05. pmid:19409507; PubMed Central PMCID: PMC2715444.
31. Munoz M, Wintaco LM, Munoz SA, Ramirez JD. Dissecting the Heterogeneous Population Genetic Structure of Candida albicans: Limitations and Constraints of the Multilocus Sequence Typing Scheme. Front Microbiol. 2019;10:1052. Epub 2019/05/28. pmid:31134042; PubMed Central PMCID: PMC6524206.
32. Marak MB, Dhanashree B. Antifungal Susceptibility and Biofilm Production of Candida spp. Isolated from Clinical Samples. Int J Microbiol. 2018;2018:7495218. Epub 2018/11/09. pmid:30405717; PubMed Central PMCID: PMC6199855.
33. Thiam HR, Wong SL, Qiu R, Kittisopikul M, Vahabikashi A, Goldman AE, et al. NETosis proceeds by cytoskeleton and endomembrane disassembly and PAD4-mediated chromatin decondensation and nuclear envelope rupture. Proc Natl Acad Sci U S A. 2020;117(13):7326–37. Epub 2020/03/15. pmid:32170015; PubMed Central PMCID: PMC7132277.
34. Thiam HR, Wong SL, Qiu R, Kittisopikul M, Vahabikashi A, Goldman AE, et al. Reply to Liu: The disassembly of the actin cytoskeleton is an early event during NETosis. Proc Natl Acad Sci U S A. 2020;117(37):22655–6. Epub 2020/09/19. pmid:32943583; PubMed Central PMCID: PMC7502743.
35. Tilley DO, Abuabed U, Zimny Arndt U, Schmid M, Florian S, Jungblut PR, et al. Histone H3 clipping is a novel signature of human neutrophil extracellular traps. Elife. 2022;11. Epub 2022/10/26. pmid:36282064; PubMed Central PMCID: PMC9665850.
36. Shankar M, Lo TL, Traven A. Natural Variation in Clinical Isolates of Candida albicans Modulates Neutrophil Responses. mSphere. 2020;5(4). Epub 2020/08/21. pmid:32817378; PubMed Central PMCID: PMC7440844.
37. Kucharikova S, Tournu H, Lagrou K, Van Dijck P, Bujdakova H. Detailed comparison of Candida albicans and Candida glabrata biofilms under different conditions and their susceptibility to caspofungin and anidulafungin. J Med Microbiol. 2011;60(Pt 9):1261–9. Epub 2011/05/14. pmid:21566087.
38. Chow JK, Golan Y, Ruthazer R, Karchmer AW, Carmeli Y, Lichtenberg D, et al. Factors associated with candidemia caused by non-albicans Candida species versus Candida albicans in the intensive care unit. Clin Infect Dis. 2008;46(8):1206–13. Epub 2008/05/01. pmid:18444857.
39. Luzzati R, Cavinato S, Giangreco M, Grana G, Centonze S, Deiana ML, et al. Peripheral and total parenteral nutrition as the strongest risk factors for nosocomial candidemia in elderly patients: a matched case-control study. Mycoses. 2013;56(6):664–71. Epub 2013/05/17. pmid:23675641.
40. Wakade RS, Ristow LC, Wellington M, Krysan DJ. Intravital imaging-based genetic screen reveals the transcriptional network governing Candida albicans filamentation during mammalian infection. Elife. 2023;12. Epub 2023/02/28. pmid:36847358; PubMed Central PMCID: PMC9995110.
41. Unger L, Skoluda S, Backman E, Amulic B, Ponce-Garcia FM, Etiaba CN, et al. Candida albicans induces neutrophil extracellular traps and leucotoxic hypercitrullination via candidalysin. EMBO Rep. 2023;24(11):e57571. Epub 2023/10/05. pmid:37795769; PubMed Central PMCID: PMC10626426.
42. Cravener MV, Do E, May G, Zarnowski R, Andes DR, McManus CJ, et al. Reinforcement amid genetic diversity in the Candida albicans biofilm regulatory network. PLoS Pathog. 2023;19(1):e1011109. Epub 2023/01/26. pmid:36696432; PubMed Central PMCID: PMC9901766.
43. Nett JE, Zarnowski R, Cabezas-Olcoz J, Brooks EG, Bernhardt J, Marchillo K, et al. Host contributions to construction of three device-associated Candida albicans biofilms. Infect Immun. 2015;83(12):4630–8. Epub 2015/09/16. pmid:26371129; PubMed Central PMCID: PMC4645408.
44. Nett J, Lincoln L, Marchillo K, Massey R, Holoyda K, Hoff B, et al. Putative role of beta-1,3 glucans in Candida albicans biofilm resistance. Antimicrob Agents Chemother. 2007;51(2):510–20. Epub 2006/11/30. pmid:17130296; PubMed Central PMCID: PMC1797745.
45. Kavanaugh NL, Zhang AQ, Nobile CJ, Johnson AD, Ribbeck K. Mucins suppress virulence traits of Candida albicans. MBio. 2014;5(6):e01911. Epub 2014/11/13. pmid:25389175; PubMed Central PMCID: PMC4235211.
46. Banerjee M, Thompson DS, Lazzell A, Carlisle PL, Pierce C, Monteagudo C, et al. UME6, a novel filament-specific regulator of Candida albicans hyphal extension and virulence. Mol Biol Cell. 2008;19(4):1354–65. Epub 2008/01/25. pmid:18216277; PubMed Central PMCID: PMC2291399.
47. Muhlschlegel FA, Fonzi WA. PHR2 of Candida albicans encodes a functional homolog of the pH-regulated gene PHR1 with an inverted pattern of pH-dependent expression. Mol Cell Biol. 1997;17(10):5960–7. Epub 1997/10/07. pmid:9315654; PubMed Central PMCID: PMC232444.
48. De Bernardis F, Muhlschlegel FA, Cassone A, Fonzi WA. The pH of the host niche controls gene expression in and virulence of Candida albicans. Infect Immun. 1998;66(7):3317–25. Epub 1998/06/25. pmid:9632601; PubMed Central PMCID: PMC108348.
49. Fonzi WA. PHR1 and PHR2 of Candida albicans encode putative glycosidases required for proper cross-linking of beta-1,3- and beta-1,6-glucans. J Bacteriol. 1999;181(22):7070–9. Epub 1999/11/13. pmid:10559174; PubMed Central PMCID: PMC94183.
50. Lionakis MS, Drummond RA, Hohl TM. Immune responses to human fungal pathogens and therapeutic prospects. Nat Rev Immunol. 2023;23(7):433–52. Epub 2023/01/05. pmid:36600071; PubMed Central PMCID: PMC9812358 2020. The other authors declare no competing interests.
51. Branzk N, Lubojemska A, Hardison SE, Wang Q, Gutierrez MG, Brown GD, et al. Neutrophils sense microbe size and selectively release neutrophil extracellular traps in response to large pathogens. Nat Immunol. 2014;15(11):1017–25. Epub 2014/09/15. pmid:25217981; PubMed Central PMCID: PMC4236687.
52. Smolarz M, Zawrotniak M, Satala D, Rapala-Kozik M. Extracellular Nucleic Acids Present in the Candida albicans Biofilm Trigger the Release of Neutrophil Extracellular Traps. Front Cell Infect Microbiol. 2021;11:681030. Epub 2021/06/15. pmid:34123878; PubMed Central PMCID: PMC8187917.
53. Margraf A, Lowell CA, Zarbock A. Neutrophils in acute inflammation: current concepts and translational implications. Blood. 2022;139(14):2130–44. Epub 2021/10/09. pmid:34624098; PubMed Central PMCID: PMC9728535.
54. Bennett RJ, Johnson AD. The role of nutrient regulation and the Gpa2 protein in the mating pheromone response of C. albicans. Mol Microbiol. 2006;62(1):100–19. pmid:16987174.
55. Reuss O, Vik A, Kolter R, Morschhauser J. The SAT1 flipper, an optimized tool for gene disruption in Candida albicans. Gene. 2004;341:119–27. Epub 2004/10/12. pmid:15474295.
56. Sung PS, Huang TF, Hsieh SL. Extracellular vesicles from CLEC2-activated platelets enhance dengue virus-induced lethality via CLEC5A/TLR2. Nature communications. 2019;10(1):2402. pmid:31160588; PubMed Central PMCID: PMC6546763.
57. Chen ST, Li FJ, Hsu TY, Liang SM, Yeh YC, Liao WY, et al. CLEC5A is a critical receptor in innate immunity against Listeria infection. Nature communications. 2017;8(1):299. pmid:28824166; PubMed Central PMCID: PMC5563510.
58. Lammermann T, Afonso PV, Angermann BR, Wang JM, Kastenmuller W, Parent CA, et al. Neutrophil swarms require LTB4 and integrins at sites of cell death in vivo. Nature. 2013;498(7454):371–5. pmid:23708969; PubMed Central PMCID: PMC3879961.
About the Authors:
Kuo-Yao Tseng
Roles: Conceptualization, Investigation, Writing – original draft
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Yu-Tsung Huang
Roles: Conceptualization, Formal analysis, Investigation, Project administration, Resources
Affiliations: Department of Laboratory Medicine, National Taiwan University Hospital, National Taiwan University College of Medicine, Taipei, Taiwan, Department of Internal Medicine, National Taiwan University Hospital, National Taiwan University College of Medicine, Taipei, Taiwan, Graduate Institute of Clinical Laboratory Sciences and Medical Biotechnology, National Taiwan University, Taipei, Taiwan
Yu-Ting Huang
Roles: Investigation, Methodology
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Yu-Ting Su
Roles: Investigation
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
An-Ni Wang
Roles: Investigation
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Wen-Yen Weng
Roles: Investigation
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Cai-Ling Ke
Roles: Methodology, Resources
Affiliation: Department of Biochemical Science and Technology, College of Life Science, National Taiwan University, Taipei, Taiwan
Yu-Chiao Yeh
Roles: Methodology, Resources
Affiliation: Department of Biochemical Science and Technology, College of Life Science, National Taiwan University, Taipei, Taiwan
Jhih-Jie Wang
Roles: Investigation
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Shin-Hei Du
Roles: Investigation
Affiliation: Department of Laboratory Medicine, National Taiwan University Hospital, National Taiwan University College of Medicine, Taipei, Taiwan
Zi-Qi Gu
Roles: Investigation
Affiliation: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan
Wei-Lin Chen
Roles: Investigation
Affiliations: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan, Program in Molecular Medicine, National Yang Ming Chiao Tung University and Academia Sinica, Taipei, Taiwan
Ching-Hsuan Lin
Roles: Methodology, Resources
Affiliation: Department of Biochemical Science and Technology, College of Life Science, National Taiwan University, Taipei, Taiwan
Yu-Huan Tsai
Roles: Conceptualization, Formal analysis, Funding acquisition, Investigation, Project administration, Supervision, Writing – original draft, Writing – review & editing
* E-mail: [email protected]
Affiliations: Laboratory of Host–Microbe Interactions and Cell Dynamics, Institute of Microbiology and Immunology, National Yang Ming Chiao Tung University, Taipei, Taiwan, Program in Molecular Medicine, National Yang Ming Chiao Tung University and Academia Sinica, Taipei, Taiwan, Center for Molecular and Clinical Immunology, Chang Gung University, Taoyuan, Taiwan
https://orcid.org/0000-0002-1374-2359
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
© 2024 Tseng et al. This is an open access article distributed under the terms of the Creative Commons Attribution License: http://creativecommons.org/licenses/by/4.0/ (the “License”), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. Notwithstanding the ProQuest Terms and Conditions, you may use this content in accordance with the terms of the License.
Abstract
Candida albicans is a leading cause of intravascular catheter-related infections. The capacity for biofilm formation has been proposed to contribute to the persistence of this fungal pathogen on catheter surfaces. While efforts have been devoted to identifying microbial factors that modulate C. albicans biofilm formation in vitro, our understanding of the host factors that may shape C. albicans persistence in intravascular catheters is lacking. Here, we used multiphoton microscopy to characterize biofilms in intravascular catheters removed from candidiasis patients. We demonstrated that, NETosis, a type of neutrophil cell death with antimicrobial activity, was implicated in the interaction of immune cells with C. albicans in the catheters. The catheter isolates exhibited reduced filamentation and candidalysin gene expression, specifically in the total parenteral nutrition culture environment. Furthermore, we showed that the ablation of candidalysin expression in C. albicans reduced NETosis and conferred resistance to neutrophil-mediated fungal biofilm elimination. Our findings illustrate the role of neutrophil NETosis in modulating C. albicans biofilm persistence in an intravascular catheter, highlighting that C. albicans can benefit from reduced virulence expression to promote its persistence in an intravascular catheter.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer






