1. Introduction
Alzheimer’s disease (AD) is a progressive neurodegenerative disorder that is responsible for the majority of dementia cases [1]. Amyloid plaques containing aggregated forms of amyloid β (Aβ) peptides represent one of the classical neuropathological hallmarks in AD brains [2,3]. Aβ is generated from the amyloid precursor protein (APP) by consecutive proteolytic cleavages executed by β- and γ-secretases [4]. Oligomeric aggregated forms of Aβ can impair synaptic function and have neurotoxic properties, and are thus believed to play a critical role in AD pathogenesis (for a recent review, see, for example, [5]). In recent years, a variety of N- and C-terminally truncated or modified versions of the canonical Aβ1–40 and Aβ1–42 species have been detected in amyloid plaques [6,7,8], and it appears that the exact length and amino sequence of both N- and C-termini affect aggregation tendency and neurotoxicity of the different Aβ-species [9,10]. For example, Aβ peptides starting with pyroglutamate at position 3 of the Aβ sequence (AβN3pE–X) were shown to be abundant in senile amyloid plaques [11]. This posttranslational modification seems to increase the oligomerization, fibrillization, and cytotoxicity of Aβ [12,13,14,15]. Interestingly, a recent solid-state NMR spectroscopy study suggested that the secondary structure of Aβ oligomers was only marginally affected by pyroglutamate-modification of the Aβ N-terminus [16]. Currently, no disease modifying treatments for AD targeting the underlying pathophysiological processes are available. Biochemical and imaging biomarkers of the pathological changes in AD are important for an early and differential dementia diagnosis, in order to identify subjects at high risk in preclinical stages and for participant selection in the context of clinical trials [17,18]. Recently, the ratios of the concentrations of specific variants of amyloid β (Aβ) in human blood plasma were discovered to predict brain amyloid pathology with high accuracy or to differentiate Alzheimer’s dementia patients and subjects with dementia due to other reasons. These plasma Aβ ratios include Aβ42/Aβ40 [19,20,21], Aβ1–40/Aβ1–42, and APP669–711/Aβ1–42 [22,23]. APP669–711 is a proteolytic fragment of the amyloid precursor protein (APP) that was identified in human blood plasma by immunoprecipitation followed by mass spectrometry [24]. The APP669–711 peptide starts three amino acids N-terminal to the canonical Aβ amino-terminus (Asp1) and encompasses the amino acid sequence of an N-terminally elongated Aβ−3–40 peptide. Neuronal BE(2)-C cells and SH-SY5Y cells overexpressing APP were shown to be able to generate Aβ−3–40 in cell culture [23,25], and it appears that its cellular production occurs independently of BACE1 [25]. The self-assembly tendency of Aβ−3–40 was found to be lower than that of Aβ1–42 [23]. To the best of our knowledge, N-terminally elongated Aβ−3–x peptides have not been identified in appreciable amounts in amyloid plaques, thus their potential significance in AD pathophysiology is currently unclear. The Aβ−3–40 (APP669–711) concentration in human blood plasma was reported to be essentially unchanged between subjects with or without amyloid-β positron-emission tomography (PET) imaging evidence of cerebral amyloid β accumulation. However, it was found to be a good reference to accentuate the selective pathological decrease in plasma Aβ1–42 in brain amyloid positive individuals. The plasma concentration ratio APP669–711/Aβ1–42 (Aβ−3–40/Aβ1–42) clearly outperformed plasma Aβ1–42 as a biomarker of brain amyloid deposition [22,23]. We report here on the characterization of a novel monoclonal antibody that was raised against the N-terminus of Aβ−3–x and on the development and technical validation of a novel immunoassay for the measurement of Aβ−3–40 in biological samples. Finally, the relative levels of Aβ−3–40, Aβ40, and Aβ42 in human blood plasma in a small clinical sample were measured after pre-concentration by semi-automated Aβ magnetic bead immunoprecipitation. We observed statistically significant differences between patients with dementia of the Alzheimer’s type (AD-D) (n = 23) and dementia due to other reasons (OD) (n = 17) regarding Aβ42 and the concentration ratios Aβ42/Aβ40 and Aβ42/Aβ−3–40.
2. Results 2.1. Antibody Characterization
An overview of APP- and Aβ-related peptides employed in this study and the nomenclature used are shown in Figure 1.
The selectivity of the purified monoclonal antibody (mAb) 101-1-1 was assessed by capillary isoelectric focusing (CIEF) immunoassay, as described previously [8,26]. MAb 101-1-1 showed a strong signal with synthetic Aβ−3–40 (100 ng/mL), but not with Aβ1–40, Aβ2–40, Aβ3–40, AβN3pE–40, Aβ4–40, or Aβ5–40. MAb 101-1-1 also recognized the antigen VKMDAEFRC coupled to bovine serum albumin (BSA) (Figure 2).
Essentially identical electropherograms indicating excellent selectivity for Aβ−3–40 were obtained with mAb 14-2-4 (anti Aβ−3–X, IBL International, Hamburg, Germany) (Figure S1). In the next step, the selectivity of mAb101-1-1 in Western blot detection of Aβ peptide variants separated under strongly denaturing conditions by urea-SDS-polyacrylamide gel electrophoresis (urea SDS-PAGE) was assessed. Again, mAb 101-1-1 showed excellent selectivity for synthetic Aβ−3–40. Under the tested conditions, no signals were observed with Aβ variants starting with Asp (1), Ala (2), Glu (3), pyroGlu (3), Phe (4), or Arg (5) (Figure 3a,b). Very similar results were obtained with mAb 14-2-4 (Figure S2). To evaluate whether the monoclonals 101-1-1 and 14-2-4 require the free N-terminal valine residue or also recognize APP or APP fragments starting N-terminal to the canonical Aβ sequence, we tested recombinant sAPPα and cell culture supernatants of H4 cells transfected with human wild type APP751 or Swedish mutant APP751SWE (K670N/M671L). Aliquots of cell culture supernatants and recombinant sAPPα were separated on a 4–12% Bis-Tris gradient gel, blotted onto PVDF (polyvinylidene difluoride membrane), and probed with mAb 101-1-1 or mAb 14-2-4 in combination with peroxidase labeled goat anti mouse IgG secondary antibody. For comparison, additional parallel blots were probed with mAb 22C11 (anti-APP) and mAb 1E8 (anti Aβ N-terminus). Both mAb 101-1-1 and 14-2-4 clearly detected recombinant sAPPα and secrected sAPP in cell culture supernatant of H4 cells overexpressing human wild type APP751, but not in conditioned medium of H4 cells overexpressing Swedish mutant APP (Figure 3c–f).
The recognition of wild type APP, but not APP carrying the Swedish double mutation KM/NL (670/671) by mAb 101-1-1 was further confirmed by immunohistochemistry (Figure 4). MAb 101-1-1 clearly stained cellular APP in brain slices from APPLd transgenic mice, but not in brain slices from 5XFAD transgenic mice. The latter express human APP and Presenilin 1 genes with a total of five mutations linked to AD, including the APP SWE double mutation. Double staining of brain slices of APPLd mice with anti Aβ42 (mAb D3E10) and mAb 101-1-1 indicated Aβ42 to be located in amyloid plaque cores, as expected. These were not recognized by mAb 101-1-1. Instead, mAb 101-1-1 signals were observed in close vicinity to the extracellular plaque cores, presumably representing APP accumulation within dystrophic neurites.
Next, the suitability of mAb 101-1-1 for magnetic bead immunoprecipitation (IP) after covalent coupling to Dynabeads M270 Epoxy was tested. Western blot analysis revealed successful IP of sAPP from conditioned media of H4APP751wt cells (Figure S3). After extended exposure, a faint peptide band co-migrating with synthetic Aβ peptides Aβ−3–40 and Aβ1–40 was also detected.
2.2. Immunoassay Development and Technical Validation
A highly selective sandwich immunoassay for measuring Aβ−3–40 (APP669–711) was developed on the Mesoscale Discovery (MSD) technology platform employing 96-well small spot streptavidin pre-coated plates. Aliquots of mAb 101-1-1 and the anti Aβ40 C-terminal mAb 280F2 were conjugated (initially on a small scale) with biotin or SULFO-TAG to serve as capture or detection antibodies, respectively. After blocking unspecific binding sites, selected wells of a 96-well small spot streptavidin plate were coated with biotinylated mAb 101-1-1 capture antibody. A series of fourfold dilutions of synthetic Aβ−3–40 in Diluent-35 (1500 pg/mL, 375 pg/mL, 93.75 pg/mL, 23.44 pg/mL, 5.86 pg/mL, 1.46 pg/mL, 0.37 pg/mL, and 0 pg/mL) was assessed. With both SULFO-TAG Aβ40 detection antibody (MSD) and SULFO-TAG mAb 280F2, reasonable dose–response curves were obtained. The lower limits of detection (LLODs) were calculated by the MSD Discovery Workbench software as the smallest analyte concentration generating a signal three standard deviations (3 × SD) above the zero calibrator (blank) (minimum error estimates activated). The observed LLODs of 24.6 pg/mL (SULFO-TAG Aβ40) and 22.7 pg/mL (SULFO-TAG 280F2) were very similar. The flipped assay design with biotinylated mAb 280F2 serving for capture and SULFO-TAG 101-1-1 for detection produced substantially lower signals and a considerably higher calculated LLOD of 72.1 pg/mL (Figure 5a). Thus, we decided to proceed with assay development using biotinylated mAb 101-1-1 for capture and SULFO-TAG Aβ40 for detection. Next, a fresh lot of biotinylated mAb 101-1-1 was prepared on a larger scale, starting from 1 mg of purified mAb 101-1-1. The mole to mole ratio of incorporated biotin to protein was estimated by HABA (4-hydroxyazobenzene-2-carboxylic acid) assay for biotin quantitation and BCA (bicinchoninic acid) assay for protein quantitation. We calculated incorporation of approximately 2.9 moles of biotin per mole of protein and IgG recovery of approximately 90%. To optimize the detection of Aβ−3–40, different concentrations of biotinylated mAb 101-1-1 capture antibody during plate coating were tested (capture antibody titration). We observed an appreciable improvement in the detection sensitivity by increasing the concentration of the capture antibody from 0.5 µg/mL to 1 µg/mL and 2 µg/mL. Further increasing the capture antibody concentration to 4 µg/mL had a negligible additional effect (Figure 5b). At this stage and based on the results obtained so far, we drafted a first version of a standard operating procedure (SOP, see below, Materials and Methods section) to be evaluated in detail in a partial “fit for purpose” assay validation campaign. A cartoon displaying the assay principle is shown in Figure S4.
2.2.1. Lower Limit of Detection, Lower Limit of Quantification, and Upper Limit of Quantification
The data analysis in each assay run included standard curve calculations with the MSD Discovery Workbench 4.0.12 software by four-parameter logistic curve fitting of raw signals obtained with seven or more fourfold serial dilutions of the synthetic Aβ−3–40 calibrator peptide plus a zero calibrator (blank). The lower limit of detection (LLOD) was calculated for each single assay plate as the lowest analyte concentration generating a signal three SDs above the lowest standard/blank with the option “use minimum error estimates” activated. The lower limit of quantification (LLOQ) was defined as the lowest analyte concentration producing a signal 10 SDs above the lowest standard/blank. Mean LLOD and LLOQ calculated from n = 5 assay runs within the validation study were 11.04 pg/mL ± 0.44 and 22.24 pg/mL ± 1.36 (mean ± SD), respectively. To assess the upper limit of quantification (ULOQ), on a single assay plate, an extended fourfold calibrator dilution series including ten fourfold serial dilutions starting at 120 ng/mL plus a zero calibrator/blank was analyzed. The ULOQ was defined as the highest calibrator concentration that showed < 20% coefficient of variation (CV) between two technical replicates (regarding both signal and calculated concentration) and 85–115% recovery (i.e., the calculated concentration had to be in the range of 85–115% of the theoretical calibrator concentration). The observed ULOQ in this experiment was 7.5 ng/mL (Figure 5c).
2.2.2. Alternative Calibrator
Aβ peptides are notoriously prone to aggregation. We thus evaluated a synthetic molecule (D7-Calibrator) comprising the Aβ−3–X N-terminal amino acid sequence VKMDAEFRH followed by 5x PEG2 (8-Amino-3,6-dioxaoctanoic acid) and the Aβ40 C-terminus GLMVGGVV (Mr: 2571) (Biosyntan, Berlin, Germany) as a potential alternative calibrator. The D7-Calibrator was designed to provide improved water-solubility and to be less prone to aggregation or adsorption. The physicochemical properties have not been studied in detail. A stock solution (3.05 mg/mL) was prepared in H2O, and further dilutions were done in Diluent-35. Fourfold serial dilutions of the D7-Calibrator starting with 1029 pg/mL produced a reasonable standard curve with an LLOD of 11.2 pg/mL (Figure 5d). To compare dose–response curves, taking into account the difference in the molecular masses of Aβ−3–40 (Mr = 4685.4) and the D7-Calibrator (Mr = 2571), the x-axis of the plot shown in Figure 5d was scaled in moles/L. At equal molar concentrations, Aβ−3–40 produced slightly higher signals than the D7-Calibrator. Nevertheless, the findings suggest that the D7-Calibrator provides an optional alternative standard/calibrator to the full length Aβ−3–40 peptide.
2.2.3. Technical Intra-Assay Repeatability and Spatial Bias
To check for potential positional effects (spatial bias), synthetic Aβ−3–40 was diluted in Diluent-35 to a final concentration of 469 pg/mL and measured in 24 technical replicates distributed across one 96-well assay plate. The coefficient of variation in terms of the measured signals was 7.6%. The mean calculated concentration was 485.8 pg/L and the coefficient of variation (%CV) between calculated Aβ−3–40 concentrations in the 24 replicates was 4.7%. Thus, in general, the technical repeatability of the assay was good. However, in position H12 (lower right corner of the assay plate), the measured signal was 23% lower than the mean signal. To exclude a systematic positional effect (spatial bias) of our system, on a second assay plate, we tested 11 technical replicates of a corresponding Aβ−3–40 dilution. The observed %CVs were 11.1% (measured signal) and 7.1% (calculated concentrations). Importantly, on this assay plate, the measured signal in position H12 was 10.3% above the mean signal, suggesting random error and arguing against systematic spatial bias. Heat maps indicating the distribution of the measured signals are shown in Figure S5.
2.2.4. Cross Reactivity/Assay Specificity
Next, we assessed the cross reactivity of the sandwich immune assay with related Aβ peptide variants and sAPPα. To that end, Aβ1–40, Aβ1–42, Aβ−3–38, and Aβ−3–42 were tested at concentrations of 4 ng/mL and 20 ng/mL and recombinant sAPPα at a concentration of 320 ng/mL. Aβ1–40, Aβ1–42, and Aβ−3–38 measurements at both tested concentrations were below the detection range of the assay plate. Aβ−3–42 produced signals within the detection range. The calculated concentrations were 12.5 pg/mL when 4 ng/mL of Aβ−3–42 was applied and 51.6 pg/mL when 20 ng/mL of Aβ−3–42 was analyzed. Thus, approximately 0.3% of the Aβ−3–42 peptide was recognized in the Aβ−3–40 assay, indicating a cross reactivity <0.5%. The signal observed with 320 ng/mL of recombinant sAPPα was below the detection range of the assay (Table 1).
2.2.5. Between-Run Variability/Inter-Assay Variance of the Aβ−3–40 Immunoassay
The initial core technical assay validation campaign included five independent runs of the Aβ−3–40 chemiluminescence immunoassay that were executed within eight weeks. On each of the five assay plates, an aliquot of a quality control (QC) sample was measured in four technical replicates. The primary intended application of the novel assay was to measure Aβ−3–40 after pre-analytical enrichment of Aβ peptides from EDTA-blood plasma by magnetic bead immunoprecipitation (IP) [21]. A QC-IP-eluate was prepared by running several IPs in parallel from pooled human blood plasma and combining the eluates after 4.8-fold dilution with Diluent-35 to a single QC-IP-eluate. Aliquots for single use were stored at −80 °C until analysis. The results obtained with the QC-IP-eluate in five independent assay runs are summarized in Table 2. The electro-chemiluminescence signals observed in the five different experiments (means of four technical replicates on each assay plate) ranged from 6755 to 8216, with a coefficient of variation of 8.2%. The mean calculated concentration of Aβ−3–40 in the QC-IP-eluate was 217 pg/mL, with a coefficient of variation of 16.3%, which was outside of the predefined acceptance range of 15% CV (Table 2). The relatively large scatter in terms of the calculated concentration of Aβ−3–40 was apparently caused by assay run #4, which seemed to differ substantially from the remaining four experiments and was identified as an outlier by Grubbs test (α = 0.05). Notably, the serial calibrator dilutions for assay run #4 had been prepared from a higher starting concentration, and thus following a slightly different experimental protocol than for the remaining experiments. This was done in order to allow for determination of the ULOQ on assay plate #4 (see above). Excluding plate #4 from the analysis reduced the CV of the measured concentrations to 4.7%. Taken together, the findings suggest that a strict standard operation procedure (SOP) covering all experimental steps including the preparation of calibrator dilutions needs to be implemented. Furthermore, a suitable QC sample should be included to allow for normalization between assay plates (see below).
2.2.6. Impact of Pre-Analytical Sample Handling Procedures
Aliquots of individual EDTA-blood plasma samples from five different donors and a pooled plasma sample were subjected to magnetic bead immunoprecipitation with mAb 1E8. Aβ-peptides were eluted by heating in 20mM bicine, 0.6% 3-((3-cholamidopropyl) dimethylammonio)-1-propanesulfonate, pH 7.6 (bicine-CHAPS), as described previously [26], and diluted 4.8-fold with Diluent-35 [21]. The diluted IP eluates were measured with the Aβ−3–40 assay freshly or after single or multiple freezing and re-thawing. We did not observe a substantial systematic impact of single or multiple freezing and thawing of the diluted IP eluates on the measured concentrations of Aβ−-3–40 (Figure 6a). A separate and independent control experiment did not suggest a general and systematic impact of a single or five repeated freeze–thaw cycles on the measurement of Aβ38, Aβ40, and Aβ42 by the V-Plex Aβ panel 1 (6E10) multiplex assay kit (Mesoscale Discovery, MSD) either (Figure S6). Consequently, pre-analytical freezing of IP eluates after dilution in Diluent-35 was implemented in the SOP. To assess the impact of reducing the blood plasma volume and dilution with Diluent-35 prior to IP, three different EDTA-plasma samples were studied. IPs were executed starting from 400 µL of EDTA plasma, from 200 µL of EDTA plasma mixed with 200 µL of Diluent-35, and from 100 µL of EDTA-Plasma mixed with 300 µL of Diluent-35. In each case, 100 µL of 5× triple detergent IP-buffer concentrate and 25 µL of 1E8 magnetic beads were added for overnight incubation. IP eluates were diluted 4.8-fold with Diluent-35 and stored at −80 °C until the analysis. As expected, after reducing the starting volume of EDTA-plasma and diluting the samples with Diluent-35, lower concentrations of Aβ−3–40 were measured in the IP eluates. In two out of the three tested blood plasma samples, the measured Aβ−3–40 concentrations decreased in a linear fashion with sample dilution (Figure 6b). In the remaining sample, we observed a slight relative increase in Aβ−3–40 recovery after sample dilution, suggesting the presence of interfering compounds (matrix effects) in undiluted EDTA-plasma.
2.2.7. Specificity of the Two-Step Immunoassay
To further evaluate the specificity of the two-step immunoassay for measuring Aβ−3–40 in human blood plasma, a number of control IPs were done and analyzed by the Aβ−3–40 immunoassay. The signals we obtained after magnetic bead immunoprecipitation from pooled EDTA-plasma using the anti-human Tau monoclonal HT7 and after 1E8-IP from 1% BSA in phosphate buffered saline (PBS) (“mock IP”) were below the detection range. The observations indicate absence of appreciable background signal owing to unspecific binding of plasma components to magnetic beads functionalized with an unrelated monoclonal antibody or from the 1E8-magnetic beads per se. Next, an Aβ-depleted plasma sample was prepared by two consecutive rounds of Aβ-IP from pooled plasma with a mixture of magnetic beads coupled with anti Aβ monoclonals 6E10 or 4G8. The measured concentrations of Aβ−3–40 were 12.3 pg/mL in the Aβ-depleted sample and 239.3 pg/mL in the corresponding control sample, indicating 95% reduction in Aβ−3–40 after Aβ depletion (Table 3).
2.2.8. Assay Interference
In an additional and separate control experiment, we assessed to what extent sAPPα, a related synthetic model peptide (Aβ−23–16), and Aβ1–40 interfered with the measurement of Aβ−3–40 in a diluted IP eluate from pooled human plasma. The model peptide Aβ−23–16 (APP649–687) (APP770 numbering) comprised 23 amino acids of the APP sequence N-terminal to the Aβ sequence followed by Aβ1–16. Both sAPPα and Aβ−23–16 are recognized by mAb101-1-1. The addition of sAPPα or Aβ−23–16 reduced the measured Aβ−3–40 concentration in comparison with the control in a dose-dependent fashion (Table 4). In contrast, the addition of Aβ1–40 affected the measurement of Aβ−3–40 only marginally, even at the highest tested concentration of 45 ng/mL. The experiment was repeated once with a comparable outcome (data not shown). Notably, assay interference by sAPPα or related APP fragments is not expected to represent a serious issue in the Aβ−3–40 two-step immunoassay, because the described magnetic bead IP with a covalently immobilized antibody against the Aβ N-terminus followed by heat elution in bicine-CHAPS pre-concentrates Aβ peptides very efficiently [21,26]. However, high concentrations of sAPP or related APP derivatives might interfere with the correct direct measurement of absolute Aβ−3–40 concentrations in biological samples, dependent on the type of sample that is analyzed.
2.2.9. Efficiency of the Aβ−3-–40 Immunoprecipitation by 1E8-Magnetic Beads
To estimate how efficiently Aβ−3–40 is immunoprecipitated under the tested experimental conditions, we performed two consecutive rounds of 1E8 IP from a pooled plasma sample. Comparison of the measured Aβ−3–40 concentrations in the IP eluates of the first and second IP round indicated high recovery after a single round of IP (Table 5). The measured Aβ−3–40 concentration after the second IP was reduced to approximately 7.5% of that observed in the eluate obtained after the first IP.
2.2.10. Analytical Spike Recoveries
Two different individual EDTA plasma samples and a pooled plasma sample were spiked with synthetic Aβ−3–40 at three different spike levels (10 pg, 20 pg, or 40 pg spiked into 400 µL of plasma) prior to immunoprecipitation with 1E8-magnetic beads. The diluted IP eluates obtained from neat and spiked samples were measured with the Aβ−3–40 assay. Spike recoveries were calculated by comparing the amount of the spike added (in pg) with the amount detected in the spiked samples after subtraction of the endogenous Aβ−3–40 peptide found in the neat sample. The observed spike recoveries are summarized in Table 6. Spike recoveries ranged from 32.5% to 99.6%, with mean values of 76% at the low spike level (10 pg of Aβ−3–40 added to 400 µL of EDTA plasma), 94% at the intermediate spike level (20 pg of Aβ−3–40 added to 400 µL of EDTA plasma), and 67% at the high spike level (40 pg of Aβ−3–40 added to 400 µL of EDTA plasma). The findings suggest a certain degree of matrix interference, which appears to vary between biological samples. In a control IP from 400 µL Diluent-35 spiked with 40 pg of Aβ−3–40, we observed 91.7% spike recovery.
2.2.11. Repeatability of Manual IPs from the Same Sample Performed in Parallel
Three different original EDTA plasma samples were studied. From each, three immunoprecipitations were executed in parallel, resulting in nine IP eluates in total. The observed coefficient of variation between the parallel IP reactions in terms of measured Aβ−3-–40 concentrations was <10% (Table 7).
2.2.12. Day-to-Day Variance of the Manual IP Procedure
On four different days within 2 weeks, 1E8-magnetic bead IPs were executed from aliquots of five different human EDTA-plasma samples (termed A, B, C, D, E). The IP eluates obtained on each of the four days were diluted with Diluent-35 and stored frozen at −80 °C. Finally, all 20 samples were thawed and measured on a single assay plate. The coefficients of variation regarding the measured Aβ−3–40 concentrations in IP eluates prepared on four different days ranged from 3.6 to 20.1%, with a mean value of 9.1% (Table S2).
2.2.13. Intra-Assay Variance/Repeatability of Aβ−3–40 Measurements in IP-Eluates
Diluted IP eluates obtained from three different original EDTA plasma samples were measured on the same assay plate in eight technical replicates each. The observed coefficients of variation between the replicate measurements were 2.2%, 2.7%, and 2%, respectively (Table S1).
2.2.14. Day-to-Day Variance of the Complete Two-Step Immunoassay and Normalization
To evaluate the intermediate imprecision (day-to-day variance) of the complete two-step immunoassay procedure (manual IP followed by immunoassay), we tested a set of three individual control plasma samples and one control plasma pool in four different experiments. In each of these four assay runs, separate immunoprecipitations were performed from aliquots of the control samples. The measured Aβ−3–40 concentrations varied substantially between the four experiments, with a mean coefficient of variation of 29.6% (Table 8). Both the IP and the subsequent Aβ−3–40 immunoassay are expected to contribute to the overall intermediate imprecision (see above). In the next step, we normalized the measured Aβ−3–40 concentrations by a QC-IP eluate included on each assay plate (see above). It served to calculate assay-plate correction factors for normalization of the error contributed by the four independent runs of the Aβ−3–40 immunoassay only. The overall mean coefficient of variation of the complete two-step immunoassay after normalization was 16.2%. This was within the predefined acceptance range (<20% CV), but still larger than the desired variance of <15% CV.
2.3. Measurement of Aβ−3–40 in Patient Samples and Determination of Aβ Ratios as AD Biomarker Candidates
The relative levels of Aβ−3–40, Aβ40, and Aβ42 were measured in 40 human blood plasma samples from patients with dementia of the Alzheimer’s type (AD-D, n = 23) and other dementias (OD, n = 17) by a semi-automated version of our two-step immunoassay. Here, the 1E8-magnetic bead IPs were executed on a CyBio FeliX liquid handling instrument (Analytik Jena GmbH, Jena, Germany) starting from 200 µL of EDTA-blood plasma mixed with 200 µL of H2O. The resulting IP eluates were diluted 4.8-fold with Diluent-35 and stored in aliquots at −80 °C until they were measured with the novel Aβ−3–40 assay and the V-Plex Aβ panel 1 (6E10) multiplex assay kit. Importantly, the clinical cohort (n = 40 subjects) studied here is the same we investigated previously using our original two-step immunoassay procedure including Aβ pre-concentration by manual IP starting from 400 µL of EDTA-plasma [21]. In all 40 samples, Aβ−3–40, Aβ40, and Aβ42 measurements were in the detection range of the assay. Baseline statistics are summarized in Table S3. The measured concentrations of Aβ−3–40, Aβ40, and Aβ42, as well as the concentration ratios Aβ42/Aβ−3–40 and Aβ42/Aβ40, showed lognormal distributions (Table S4). Thus, we performed pairwise comparisons of means between the diagnostic groups OD (n = 17) and AD-D (n = 23) by multiple t-tests on log2-transformed data. The p-values were corrected for multiple comparisons using the Holm–Sidak method with α = 0.05 and without assuming a consistent SD. There were no statistically significant differences between the diagnostic groups OD and AD-D regarding the mean concentrations of Aβ−3–40 and Aβ40 (log2-transformed data). Aβ42, the Aβ42/Aβ40 ratio, and the Aβ42/Aβ−3–40 ratio (log2 transformed data) were statistically significantly lower in the AD-D patients (Table 9).
The diagnostic potential of plasma Aβ42 and the Aβ42/Aβ40 and Aβ42/Aβ−3–40 ratios for the discrimination between OD versus AD-D in this clinical sample was compared by receiver operating characteristic (ROC) analyses. The areas under the ROC curves (AUCs) were 0.760 for Aβ42, 0.790 for the Aβ42/Aβ−3–40 ratio, and 0.854 for the Aβ42/Aβ40 ratio (Figure 7).
3. Discussion
Affordable blood-based surrogate biomarker assays that can reliably detect AD associated pathological changes at an early disease stage have enormous potential to support early and preclinical diagnosis and the development of novel, disease modifying treatments. Recent studies have shown that specific forms of the Aβ peptide can be detected in human blood plasma and represent highly promising AD biomarker candidates. For example, a multimer detection system employing two antibodies with overlapping N-terminal Aβ-epitopes for measuring Aβ oligomerization after spiking synthetic Aβ into blood plasma samples has been developed [27]. Correlations between the plasma oligomerized Aβ and CSF Aβ42, amyloid-positron-emission tomography (PET) results [28], and measures of cognitive functions [29,30] were reported. Other research groups discovered that the plasma ratios Aβ42/Aβ40, Aβ1–40/Aβ1–42, and APP669–711/Aβ1-42 (i.e., Aβ−3–40/Aβ1–42), as measured by immunoprecipitation followed by mass spectrometry, predicted brain amyloid pathology with high accuracy [19,20,23]. To the best of our knowledge, so far, commercial antibodies against N-terminally elongated Aβ−3–X or immunoassays for the specific measurement of Aβ−3–40 have not been available.
To set the groundwork for studying the biology of Aβ−3–40 in more detail in future studies and for assessing Aβ−3–40 as a potential reference for accentuating the AD-associated selective decrease in Aβ42 in blood plasma and possibly other biological fluids, we have characterized two novel antibodies raised against the Aβ−3–X N-terminus and developed a highly selective sandwich immunoassay for measuring Aβ−3–40. Our observations show that the monoclonal antibodies 101-1-1 and 14-2-4 can detect Aβ−3–40 without appreciable cross-reactivity with the canonical Aβ1–40 or N-terminally truncated Aβ-variants in CIEF immunoassay and urea-SDS-PAGE/Western blot analysis. As it turned out, neither of the two antibodies are specific for the free N-terminal valine. Both also recognize amyloid precursor protein (APP), provided it does not carry the Swedish (K670N/M671L) double mutation located directly N-terminal to the β-secretase cleavage site. Whether or not the mAbs 101-1-1 and 14-2-4 display preferences for monomeric, oligomeric, or aggregated forms of the N-terminally elongated Aβ−3–40 has not been assessed explicitly here. Published in vitro experiments including Thioflavin-T aggregation assay, size exclusion chromatography, and circular dichroism suggested a substantially lower self-aggregation tendency of Aβ−3–40 than Aβ1–42 [23]. To the best of our knowledge, Aβ−3–40 has not been reported in amyloid plaques so far, and essentially no information regarding its potential role in AD pathogenesis is available. In brain slices from APPLd transgenic mice analyzed in our present study, mAb 101-1-1 appeared to bind neuronal cell bodies and to dystrophic neurites resembling abnormal neuronal processes, but not to plaque cores. Presumably, the observed signals represent cellular APP.
MAb 101-1-1 was selected to serve as the capture antibody in the finalized version of our novel Aβ−3–40 immunoassay. The LLOD of the assay for measuring Aβ−3–40 was approximately 11 pg/mL, and the quantitative assay range was approximately 22 pg/mL–7.5 ng/mL. We did not observe appreciable cross reactivity with Aβ1–40, Aβ1–42, Aβ−3–38, and sAPPα. In contrast, at high concentrations, synthetic Aβ−3–42 produced measurable signals, indicating low cross reactivity at a level of <0.5%. The technical intra-assay repeatability passed the predefined acceptance limit of <15% CV, and we did not find evidence for systematic spatial bias. The inter-assay CV of the calculated Aβ−3–40 concentration in a QC IP eluate that was measured in five independent experiments within the assay validation campaign was 16.3%, and thus outside of the predefined 15% CV acceptance range. It appeared that the large scatter was owing to a single experiment in which the calibrator dilution series had been prepared in a slightly deviant way (to allow for determination of the ULOQ in this particular assay run). Accordingly, we conclude that a strict SOP covering all pre-analytical and analytical steps in detail has to be implemented to minimize inter-assay variability.
The primary intended purpose of the novel assay is the assessment of Aβ−3–40 and the Aβ42/Aβ−3–40 ratio (or reverse) in human blood plasma as a candidate biomarker of AD. In view of published observations from IP mass spectrometry studies [22,23,24], the blood concentration of Aβ−3–40 was expected to be small. Thus, we decided to pre-concentrate Aβs from plasma by magnetic bead immunoprecipitation and to analyze the Aβ−3–40 plasma level by a two-step immunoassay procedure, essentially as described previously for the measurement of Aβ38, Aβ40, and Aβ42 [21]. A control experiment with a pooled blood plasma sample confirmed high yield of Aβ−3–40 after a single round of 1E8 magnetic bead IP. Pre-analytical freezing and thawing of diluted IP eluates did not seem to substantially and systematically affect the measurement of Aβ−3–40. Consequently, freezing of the diluted IP eluates at −80 °C was implemented in our two-step immunoassay protocol to completely separate pre-analytical Aβ-enrichment from the actual measurement, and thus facilitate the execution of the two-step immunoassay under routine laboratory conditions. Furthermore, this allowed for testing a semi-automated prototypic IP procedure executed at a different site (see below). We have shown that the two-step immunoassay for Aβ−3–40 is highly selective. We did not observe appreciable signals in plasma IP eluates from magnetic bead IP with an unrelated antibody or from a simulated IP with 1E8 magnetic beads. Thus, unspecific binding of other plasma components to functionalized anti mouse IgG magnetic beads or background signal directly stemming from the 1E8 coupled beads could be excluded. Depleting Aβ by two rounds of IP with anti Aβ mAbs 6E10 plus 4G8 prior to the 1E8 IP reduced the measured Aβ−3–40 concentration by approximately 95%.
Analytical spike recoveries in the two-step immunoassay varied substantially between the tested plasma samples and different spike levels indicating matrix interferences. Thus, the measured Aβ−3–40 levels in the diluted IP eluates do not allow for calculating the true, absolute concentrations of this Aβ peptide in plasma samples, but have to be considered relative. The intermediate imprecision (between-run variance) of the complete manual two-step immunoassay reached an acceptable CV of 16.2% only after normalization. Notably, in this case, the normalization addressed the technical error contributed by the Aβ−3–40 assay only, not the scatter of the manual IP procedure. Without normalization, the mean between-run CV of the measured Aβ−3–40 concentrations in four QC-samples was 29.6%, and thus clearly above the predefined acceptance criterion of <20% CV. In conclusion, appropriate QC samples allowing for normalization should be included in future experiments, whenever possible, and further technical improvement is desirable.
To finally test the novel Aβ−3–40 immunoassay on biological samples in a pilot study and to demonstrate the possibility of automation of the magnetic bead IP, we studied the same small clinical sample we have previously described in detail [21]. In our current study, Aβ was pre-concentrated from 1:2 dilutions of blood plasma with water by a prototypic semi-automated 1E8 magnetic bead IP protocol. The IP eluates were diluted 4.8-fold with Diluent-35 and frozen in aliquots for single use at −80 °C. For measuring Aβ−3–40, Aβ40, and Aβ42 at a different site, the samples were transported on dry ice. We did not observe a statistically significant difference in the mean (log2 transformed) Aβ−3–40 levels between patients with AD-D (n = 23) and OD (n = 17). In contrast, Aβ42 and the Aβ ratios Aβ42/Aβ−3–40 and Aβ42/Aβ40 were statistically significantly lower in patients with AD-D compared with those in the OD group. These findings are in agreement with the IP mass spectrometry data collected in two independent cohorts by Nakamura et al. [23]. The areas under the ROC curves in our small data set were 0.76 (Aβ42), 0.79 (Aβ42/Aβ−3–40 ratio), and 0.85 (Aβ42/Aβ40 ratio). These observations support the idea that a suitable reference may serve to accentuate the pathological AD-associated decrease in soluble Aβ1–42 [22] (or Aβ42, respectively). Furthermore, our findings show that a prototypic semi-automated pre-analytical IP protocol works and that the adaptions and modifications to the original manual two-step immunoassay that were implemented did not lead to masking or loss of the reduced Aβ42/Aβ40 plasma ratio as a peripheral diagnostic biomarker of AD. Further studies employing independent and larger clinical cohorts will be required to assess the diagnostic potential of the two-step immunoassay for the Aβ42/Aβ−3–40 ratio in detail. Preferably, healthy controls and patients in different stages of AD should be included
In summary, we have developed a novel, highly selective sandwich immunoassay for measuring Aβ−3–40 in biological samples. In combination with pre-analytical Aβ enrichment by magnetic bead IP, the assay can serve to measure the relative levels of Aβ−3–40 in human blood plasma. Thus, the methodological groundwork has been set for future studies addressing the diagnostic potential of the Aβ42/Aβ−3–40 ratio (or reverse) as a novel surrogate biomarker candidate of cerebral amyloid deposition. 4. Materials and Methods Antibodies: The mouse monoclonal antibody (mAb) 101-1-1 was developed, produced, and purified by Biogenes GmbH (Berlin, Germany) on a fee for service basis. The synthetic peptide VKMDAEFRC-amide (Biosyntan, Berlin, Germany) was conjugated to bovine thyroglobulin as carrier protein and served for immunization of mice. Hybridoma cells were screened by ELISA using Aβ1–40 and Aβ2–40 for negative screening and VKMDAEFRC-BSA-conjugate for positive screening. Clone 101-1-1 was obtained after two rounds of cloning. We received 88 mg of purified monoclonal antibody mAb 101-1-1 for antibody characterization, assay development, assay validation, and further use. Monoclonal anti Aβ−3–x, clone 14-2-4, was obtained from IBL International/Tecan, (Hamburg, Germany). MAb 1E8 (anti Aβ N-terminus) and mAb 5C3 (anti Aβ40) were purchased from nanoTools GmbH (Teningen, Germany). MAb 280F2 (anti Aβ40) was obtained from Synaptic Systems (Goettingen, Germany), mAb 6E10 from Biolegend (San Diego, CA, USA), anti APP mAb 22C11 from Merck-Millipore (Darmstadt, Germany), and anti-Human Tau mAb HT7 from Thermo Scientific (Waltham, MA USA). The rabbit monoclonal anti Aβ42 antibody mAb D3E10 was purchased from Cell Signaling Technology (Danvers, MA, USA), while the rabbit polyclonal anti C-terminus APP A8717 was purchased from Sigma-Aldrich (Munich, Germany). SULFO-TAG Aβ40 detection antibody was obtained from Mesoscale Discovery, Rockville, MD, USA. Biotinylated horse anti-mouse IgG was purchased from Vector Laboratories (Burlingame, CA, USA), streptavidin-biotinylated peroxidase complex from GE Healthcare, Chicago, IL, USA), and goat anti mouse IgG peroxidase conjugate from Calbiochem/Millipore/Merck (Darmstadt, Germany). Biotinylated secondary anti-mouse and anti-rabbit antibodies, used in DAB-immunohistochemical staining, were obtained from DAKO/Agilent (Waldbronn, Germany). Fluorescent goat anti-Mouse IgG (DyLight 594) donkey anti-Rabbit IgG (DyLight 488) secondary antibodies were purchased from Thermo Scientific (Waltham, MA, USA).
Recombinant sAPPα was obtained from Sigma-Aldrich (Munich, Germany). Aβ−3–40, Aβ−3–38, and Aβ−3–42 were synthesized as described in detail previously [25]. The synthetic peptides Aβ1–40, Aβ2–40, Aβ3–40, AβN3pE–40, Aβ4–40, and Aβ5–40 were obtained from AnaSpec (Fremont, CA, USA). The synthetic model peptide Aβ−23–16 (APP649–687) (H2N-GLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQK-CONH2) was synthesized using standard solid-phase fluorenylmethoxycarbonyl (Fmoc) chemistry. Quality control of the purified product was performed by reversed-phase high-performance liquid chromatography coupled to a single-quadrupole mass spectrometer (Alliance/QDa, Waters Corporation, Milford, MA, USA) and by high-resolution mass spectrometry using a MALDI-TOF/TOF mass spectrometer (UltrafleXtreme, Bruker, Billerica, MA, USA).
The CIEF immunoassay was performed as described before [8,26]. For chemiluminescence detection, goat anti-mouse IgG, streptavidin-peroxidase conjugate, and Luminol/peroxide (all 3 reagents obtained from ProteinSimple, San Jose, CA, USA) were employed.
Preparation of functionalized anti-Aβ magnetic beads: Dynabeads M280 sheep anti mouse IgG (ThermoFisher Scientific, Waltham, MA, USA) were functionalized by covalent coupling to mAb 1E8 according to the manufacturer’s instructions and as described before [21]. Dynabeads M-270 Epoxy (Invitrogen/ThermoFisher Scientific, Waltham, MA, USA) were covalently coupled to mAb 101-1-1 following the manufacturer’s instructions.
Antibody labeling: For small-scale biotinylation and SULFO-Tag labeling, 80 µL of a 1 mg/mL stock solution of mAb 101-1-1 or 280F2 was buffer-exchanged into MSD conjugation buffer (PBS, pH 7.9, preservative-free) on a Zeba Spin Desalting column 40 K MWCO, 0.5 mL (Thermo Scientific, Waltham, MA, USA). The buffer-exchanged antibody solution was divided into two halves, each containing approximately 40 µg of IgG. For biotinylation, 3 µL of a 0.9 nmol/µL Sulfo-NHS-LC biotin solution (EZ-Link Micro Sulfo-NHS-LC Biotinylation kit, Thermo Scientific, Waltham, MA, USA) was added to approximately 40 µg of IgG (challenge ratio: 10:1) and mixed immediately on a vortex mixer. After 2 h incubation at 23 °C, excess biotin was removed by buffer exchange into MSD conjugate storage buffer (PBS, pH 7.4 containing 0.05% sodium azide) on a Zeba Spin Desalting column (40 K MWCO, 0.5 mL). For storage at −20 °C, glycerole was added to a final concentration of 50% (v/v). For SULFO-TAG labeling, 1.8 µL of a 3 nmol/µL solution of MSD Gold SULFO-TAG NHS-Ester (Mesoscale Discovery, Rockville, MD, USA) was added dropwise to approximately 40 µg of buffer exchanged IgG (see above, challenge ratio: 20:1). After mixing by pipetting up and down, the reaction was incubated for 2 h at room temperature in the dark. The remaining reagent was removed by buffer exchange into MSD conjugate storage buffer on a Zeba Spin desalting column (40 K MWCO, 0.5 mL). Storage: at 4 °C in the dark. For the biotinylation of mAb 101-1-1 on a larger scale, 159 µL of 101-1-1 [6.3 mg/mL] was mixed with 841 µL of PBS (0.1 M sodium phosphate/0.15 M NaCl, pH 7.2, Thermo Scientific, Waltham, MA, USA) and buffer exchanged into PBS (0.1 M sodium phosphate/0.15 M NaCl, pH 7.2, Thermo Scientific) on a Zeba Spin desalting column (5 mL, 7000 MWCO, Thermo Scientific, Waltham, MA, USA). Then, 7.4 µL of a 9 nmol/µL Sulfo-NHS-LC biotin stock solution was added (challenge ratio 10:1) and mixed on a vortex immediately. After incubation for 2 h at 23 °C, excess biotin was removed by buffer exchange into PBS. The protein concentration was measured by microplate BCA protein assay (PIERCE/ThermoFisher Scientific, Waltham, MA, USA) and the level of biotin incorporation was determined by HABA (4-hydroxyazobenzene-2-carboxylic acid) assay in a microplate according to the instructions to the EZ-Link Sulfo-NHS-Biotinylation Kit (Themo Scientific, Waltham, MA, USA). BSA and sodium azide were added to the biotinylated antibody to final concentrations of 1% and 0.05%, respectively. For long term storage, half of the material was aliquoted and frozen at −80 °C. The remaining biotinylated antibody stock was supplemented with 40% (v/v) ethylene glycol and stored in aliquots at −20 °C.
Urea-SDS-PAGE and semi dry blotting: Aβ-peptides were separated by urea-bicine/bis-tris/tris/sulfate SDS-polyacrylamide gel electrophoresis [31] on 12%T/5% C gels and subsequently transferred on PVDF membranes by semi dry blotting, essentially as described previously [32,33]. The protein transfer occurred at a constant current of 0.8 mA/cm2 for 30 min with a voltage limit of maximum 30 V.
Bis-Tris Gradient Gel electrophoresis and Western blotting: Proteins and peptides were separated on a 4–12% Bis-Tris gradient gel (Anamed Elektrophorese GmbH, Groß-Bieberau, Germany) at 200 V for 30 min with MES (2-(N-morpholino)ethanesulfonic acid) running buffer (50 mM MES, 50 mM Tris, 0.1% w/v SDS, 1 mM EDTA). NuPAGE antioxidant (Thermo Fisher Sientific, Waltham, MA, USA) was added to the upper buffer chamber. The proteins were subsequently blotted onto PVDF membranes using 25 mM Bicine, 25 mM Bis-Tris pH 7.2, 1 mM EDTA, and 10% (v/v) methanol transfer buffer with NuPAGE antioxidant at 20 V for 60 min (MiniGel Tank and Blot Module obtained from Invitrogen/Thermoscientific, Waltham, MA, USA).
Immunohistochemistry: Experiments involving animal tissues were approved by the local animal care and use committee (Landesamt für Verbraucherschutz und Lebensmittelsicherheit (LAVES), Lower Saxony). Brain tissue slides from 12-month-old 5XFAD [34] and 15-month-old APP/Ld transgenic mice [35] were stained as published elsewhere [36]. In brief, 4 µm paraffin sections were deparaffinized in xylene and rehydrated in a series of ethanol, followed by incubation in PBS containing 1% H2O2 to block endogenous peroxidases. Antigen-retrieval was carried using microwave treatment in 0.01 M citrate buffer pH 6.0 and incubation in 88% formic acid. Non-specific binding sites were blocked with 4% skim milk in PBS containing 10% fetal calf serum. This was followed by overnight incubation with 101-1-1 (1:10,000) or APP C-term (A8717, Sigma Aldrich, Munich, Germany, 1:3000) in a humid chamber. Staining was visualized using the ABC method with a Vectastain Kit (Vector Laboratories, Burlingame, CA, USA) and diaminobenzidine. In the case of fluorescent staining, 101-1-1 (1:6000) and the Aβ42-specific antibody D3E10 (1:1000) (Cell Signaling Danvers, MA, USA) were used and detected using anti-mouse-DyLight-594 or anti-rabbit-Dylight-488 antibodies (both Thermo Fisher, Waltham, MA, USA).
Manual and automated immunoprecipitations: Magnetic bead immunoprecipitations (IPs) by hand starting from 400 µL of EDTA-blood plasma were performed as described previously [21]. An adapted protocol for a semi-automated IP procedure was executed on a CyBio FeliX liquid handling Instrument (Analytik Jena, Jena, Germany) equipped with BioShake 3000-Telm (Q Instruments, Jena, Germany) and MAGNUM FLX Enhanced Universal Magnet Plate, Alpaqua Engineering, LLC, Beverly, MA, USA.
Aliquots of EDTA-blood plasma samples (approximately 500 µL per sample), which had been stored at −80 °C in Matrix vials, were thawed and transferred into 1.5 mL reaction vials. The vials were mixed vigorously on a vortex mixer (5 × 10 s), and insoluble material was pelleted by centrifugation for 10 min at 10,000× g at room temperature in a fixed angle rotor. Then, 220 µL of each supernatant was transferred into a 96-well sample plate (Deep Well MegaBlock®, 96 wells, 2.2 mL, PP (Sarstedt, Nümbrecht, Germany)) and manually mixed with 220 µL of H2O.
The sample plate was mounted into the CyBio FeliX instrument and preparation of immunoprecipitation mixes was carried out automatically by adding 100 µL of 5× IP buffer concentrate [21] and 25 µL of 1E8 magnetic beads to 400 µL of the diluted samples. Finally, the instrument transferred the preparations into a process plate (Deep Well MegaBlock®, 96 wells, 2.2 mL, PP (Sarstedt, Nümbrecht, Germany)).
The process plate was then manually placed in the “process” position of the CyBio FeliX instrument and the immunoprecipitation process was executed automatically. The process included an 18-h incubation at room temperature, where the samples were regularly mixed. Then, the process plate was moved into a magnet position for 120 s for immobilization of the magnetic beads. The supernatant was aspirated and discarded, and the process plate was moved back to the process position. Per well, 1 mL of wash buffer (PBS containing 0.1% w/v BSA) was added and the beads were washed for 5 min at room temperature with agitation. The plate was moved to the magnet position for bead immobilization and removal of the wash fluid as described. Then, the plate was moved back to the process position for a second wash. In total, the magnetic bead immune complexes were washed 3× for 5 min with PBS/0.1% w/v BSA and once for 3 min with 1 mL of 10 mM Tris-HCl, pH 7.5. After removal of the wash buffer, 2 × 25 µL of elution buffer (20 mM Bicine, pH 7.6, 0.6% w/v CHAPS) were added, and the beads were resuspended by aspirating and dispensing. The resuspended beads were then transferred into a preheated elution plate (Deep Well MegaBlock®, 96 wells, 1.2 mL PP (Sarstedt, Nümbrecht, Germany)) positioned on the BioShake and incubated for 5 min at 95 °C and 800 rpm to allow elution of the bound Aβ peptides. Then, the suspension was quantitatively moved to a 96-well plate (Deepwell plate 96/500 µL Protein LoBind (Eppendorf, Hamburg, Germany)) located on the magnet and incubated for 120 s for cooling and bead immobilization. Subsequently, 190 µL of Diluent-35 was added to each well (4.8-fold dilution of the IP eluates) and the samples were mixed. Finally, 200 µL of each diluted IP eluate was transferred into a separate plate (Deepwell plate 96/500 µL Protein LoBind (Eppendorf, Hamburg, Germany)). Aliquots of 60 µL each were manually pipetted into 1.5 mL reaction vials and frozen at −80 °C.
Measurements of Aβ40 and Aβ42: Aβ40 and Aβ42 levels in 4.8-fold diluted IP eluates were measured with the V-Plex Aβ panel 1 (6E10) multiplex assay kit (Mesoscale Discovery, MSD, Rockville, MD, USA) according to the manufacturer’s instructions and as described previously [21]. In the current version of the two-step immunoassay protocol, the 4.8-fold diluted IP eluates were measured after storage at −80 °C and singular thawing.
Development of the Aβ−3–40 immunoassay: The novel sandwich immunoassay for the measurement of Aβ−3–40 was developed on the MSD technology platform (Mesoscale Discovery, MSD, Rockville, MD, USA) using MSD Gold 96-well Small Spot streptavidin plates and various MSD reagents, including 20× wash buffer, Diluent-100, Diluent-35, Blocker A, 4× Read buffer, and SULFO-TAG Aβ40 detection antibody. In the final assay protocol (SOP), 150 µL of 3% (w/v) Blocker-A in wash buffer was added to the wells of a 96-well Small Spot streptavidin plate. The plate was sealed with an adhesive foil and incubated for 1 h at room temperature with shaking (500 rpm) on an Eppendorf Thermomix with a lightproof cover. The blocking solution was discarded and the plate was washed three times with 200 µL of wash buffer per well. For plate coating, 25 µL of a 2 µg/mL dilution of the biotinylated capture antibody in Diluent-100 was added per well. The plate was sealed with an adhesive foil and incubated for 1 h at room temperature with shaking (as described above). After three washes with 200 µL of wash buffer per well, 25 µL of sample or calibrator dilution per well was pipetted into the assay plate. The plate was sealed with an adhesive foil and incubated for 1 h at room temperature with shaking (see above). After three washes with 200 µL of wash buffer per well, 25 µL of detection antibody diluted in Diluent-100 was added to each well. Again, the plate was sealed with an adhesive foil and incubated for 1 h at room temperature with shaking (500 rpm) on an Eppendorf Thermomix with a lightproof cover. After three washes with 200 µL of wash buffer per well, 150 µL of 2× Read buffer was added to each well by reverse pipetting. Formation of bubbles must be avoided at this stage. The electro-chemiluminescent signals were recorded on an MSD Quickplex SQ120 reader and analyzed with the MSD Discovery Workbench Software version 4.0.12.
The synthetic calibrator peptide Aβ−3–40 was synthesized as described before [25]. The lyophilized peptide was initially solubilized in DMSO (dimethyl sulfoxide) at a concentration of 1 mg/mL and stored in aliquots at −80 °C. Starting from this master stock solution in DMSO, a 600 ng/mL calibrator stock solution for use in the novel Aβ−3–40 immunoassay was prepared in Diluent-35 and stored in aliquots for single use at −80 °C. In most experiments, seven serial calibrator dilutions in Diluent-35 plus a zero calibrator (blank) were measured for calculating the standard curve by four-parameter logistic curve fitting. The seven calibrator solutions (standards) were prepared by serial fourfold dilution in Diluent-35 starting with the highest standard to be measured. During the assay validation campaign, in most cases, the highest standard had a concentration of 1875 pg/mL. For the study of the clinical sample, the highest standard contained 7.5 ng/mL of Aβ−3–40. In one experiment, an extended fourfold calibrator dilution series including ten fourfold serial dilutions starting at 120 ng/mL plus zero calibrator (blank) was analyzed to determine the ULOQ. The alternative synthetic D7-Calibrator (VKMDAEFRH followed by 5× PEG2 (8-amino-3,6-dioxaoctanoic acid) and the Aβ40 C-terminus GLMVGGVV) (Mr: 2571.4)) was synthesized by Biosyntan (Berlin, Germany).
Cell culture: H4 cells stably overexpressing Swedish mutant APP751SWE [37] were cultured in D-MEM/F12, supplemented with 10% fetal calf serum, 2 mM L-Alanyl-L-Glutamine, non-essential amino acids, and 500 µg/mL Hygromycin. To generate H4 cells stably overexpressing wild type APP751, the human amyloid beta A4 protein isoform b precursor cDNA (also known as PreA4 751, APP 751) was subcloned into a pCI-neo mammalian expression vector (Promega, Walldorf, Germany). H4 neuroglioma cells from the exponential growth phase were seeded at 5 × 105 cells/cm² in H4 growth medium (DMEM supplemented with 4.5 g/L glucose, 4 mM L-glutamine, 10% (v/v) fetal bovine serum, 100 IU/mL penicillin, and 100 μg/mL streptomycin) 24 h before the transfection. Medium changes with serum free DMEM/Ham´s F12 with G5 supplement were performed 3 h before and directly before the transfection. Plasmid DNA and CaCl2 were mixed with N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid (BES) buffer with pH 6.98, yielding final concentrations of 25 mM BES, 140 mM NaCl, 0.75 mM Na2HPO4, 125 mM CaCl2, and 37.5 ng/µL plasmid DNA. For the transfection of a growth area of 9.5 cm², 200 µL of the mixture was incubated for 20 min at room temperature in the dark and subsequently added to the cells. The culture medium was changed to growth medium 24 h after transfection. After 48 h, 500 µg/mL G418 (Thermo Fisher Scientific, Waltham, MA, USA) was added and resistant clones were selected by limiting dilution at <0.2 cells/well in H4 growth medium with 500 µg/mL G418. The cells were maintained in the presence of 500 µg/mL G418. Six clones were isolated and assessed for the level of APP expression. The cells were cultured in DMEM GlutaMAX (Thermo Fisher, Waltham, MA, USA) supplemented with 10% superior fetal bovine serum (Biochrom, Berlin, Germany) and 500 µg/mL G418.
Study approval and study cohort. The study was conducted in accordance with the Declaration of Helsinki. The pseudonomized collection of biological samples and clinical data in a local biobank and their use in biomarker studies was approved by the ethics committee of the University of Göttingen (9/2/16). All subjects or their legal representatives gave their informed consent prior to inclusion. The clinical sample comprising n = 23 patients with dementia of the Alzheimer’s type (AD-D) and n = 17 patients with dementia due to other reasons (OD) has been described in detail in a previous study [21]. The preparation and storage of blood plasma samples according to standardized protocol were described before (ibid.).
Statistical analysis: For statistical analysis and graphical representation of data, we employed GraphPad Prism 8.4 and IBM SPSS Statistics 26.
Normalization between assay plates. On each assay plate in the core validation campaign, we included the measurement of an aliquot of a quality control (QC) IP eluate in four technical replicates. It served to assess the between-run variance of the Aβ−3–40 assay and to allow for testing a method for normalization between assay plates. The QC-IP eluate was prepared by running several IPs in parallel from pooled human blood plasma and combining the obtained IP eluates after 4.8-fold dilution to a single QC-IP eluate. Aliquots for single use were stored frozen at −80 °C until the analysis. For normalization, the average concentration of Aβ−3–40 in the QC-IP eluate (mean of four independent assay runs) was calculated as follows:
cavg= ∑i=1ncm
where cm = measured concentration, mean of the replicate measurements on the respective assay plate, and cavg = mean concentration (average of n = 4 plates considered).
Subsequently, plate correction factors (k) for each assay plate were calculated as follows:
k=cavgcm
Finally, the normalized Aβ−3–40 concentrations (cnorm) were calculated with the following formula:
cnorm=cm∗k
The normalization by the QC IP eluate was applied to the data obtained with aliquots of a set of three individual control plasma samples and a control plasma pool that were analyzed by the complete two-step immunoassay procedure (i.e., IP followed by Aβ−3–40 measurement) in four independent experiments. It should be noted that the described normalization procedure considered only the experimental error contributed by the 96-well plate immunoassay, but not the error contributed by the manual immunoprecipitation.
Figure 1. Amino acid sequences and numbering of the Aβ variants and amyloid precursor protein (APP)-related peptides that were studied. On top, a schematic diagram of the primary structure of the human APP770 isoform is shown. The Aβ peptide region, sAPPβ, and the APP intracellular domain (AICD) are indicated by different colours. Partial amino acid sequences of wild type APP770 and a mutant APP are shown in the middle panel. The positions of the Swedish (K670N/M671L) double mutation as well as the I716V (London) and V717I (Florida) mutations are highlighted in red colour. In the lower panel, the amino acid sequences and nomenclature of the 11 different synthetic peptides employed in this study are summmarized.
Figure 2. Monoclonal antibody 101-1-1 recognizes Aβ-3-40 with high selectivity on capillary isoelectric focusing immunoassay. A series of synthetic Aβ peptides with different N-termini was separated by isoelectric focusing in microcapillaries, immobilized by a photochemical reaction, and probed with (a) mAb 6E10 (2 µg/mL) or (b) mAb 101-1-1 (2.1 µg/mL). Chemiluminescent detection was achieved with biotinylated goat-anti mouse IgG antibody in combination with streptavidin-HRP (streptavidin horseradish peroxase conjugate) and chemiluminescent substrate. The specific Aβ variants loaded in the different capillaries as single peptides or in mixtures are indicated. Aβ1-40, Aβ2-40, Aβ3-40, Aβ4-40, Aβ5-40, and Aβ-3-40 were loaded at a concentration of 100 ng/mL. The tested concentration of AβN3pE-40 and VKMDAEFRC-bovine serum albumin (BSA) was 200 ng/mL.
Figure 3. Western blot analysis of antibody selectivity. Upper panel: (a) The indicated synthetic Aβ peptides with different N-termini were separated on a 12%T/5% C urea-SDS-polycacrylamide gel, blotted onto PVDF, and probed with mAb 101-1-1 (1 µg/mL) in combination with goat anti-mouse IgG-peroxidase conjugate (1:30,000 dilution in PBS-T (phosphate buffered saline containing 0.075% Tween 20)). The peptide amounts loaded on the gel were 25 ng (Aβ4-40 and Aβ5-40) and 10 ng (remaining Aβ peptides), respectively. (M) Protein ladder; (Aβ mix-1) mixture containing 10 ng of each of Aβ1-37, Aβ1-38, Aβ1-39, Aβ1-40, and Aβ1-42; (Aβ mix-2) mixture containing 10 ng of each of Aβ1-37, Aβ1-38, Aβ1-39, Aβ1-40, Aβ1-42, and Aβ-3-40. The image was recorded after 5 min exposure. Image display: high: 65,535; low: 0; gamma: 0.6. (b) Reprobing of the same PVDF membrane without stripping with mAb 6E10 (1 µg/mL). Image recorded after 3 min exposure. Image display: high: 65,535; low: 0; gamma 0.61. Lower panel: Conditioned cell culture media of transfected H4 cells overexpressing Swedish mutant or wild type human APP751 and recombinant sAPPα (stock solution prepared in Diluent-35) were separated by SDS-polyacrylamide gel electrophoresis; blotted onto PVDF; and immuno-stained with (c) mAb 101-1-1, (d) mAb 14-2-4, (e) mAb 22C11, and (f) mAb 1E8. (M) Protein ladder; (1) 0.5 µL of cell culture supernatant H4APP751SWE; (2) 0.5 µL of cell culture supernatant H4APP751wt; and (3) 6.7 ng of recombinant sAPPα. Blot exposure times: mAb 101-1-1: 15 min, mAb 14-2-4: 6 min, mAb 22C11: 2 min, and mAb 1E8: 6 min. Image display (all four blots): max: 65,535; min: 0, gamma: 0.6). * Aβ (tentative assignment).
Figure 4. Immunohistochemical staining of Alzheimer's disease (AD) transgenic mouse models. (a) Staining using an antibody directed against the carboxyterminus of APP (APP C-term) showed abundant cellular and neuritic immunoreactivity in 5XFAD and APPLd mice (left). In contrast, 101-1-1 showed an abundant staining only in APPLd mice harboring APP with an aminoterminal wildtype (K670-M671) sequence, but a complete lack of immunoreactivity in 5XFAD mice overexpressing APP with the Swedish mutation (N670-L671) (right). (b) Double-staining using an Aβ42-specific antibody (D3E10, green) and 101-1-1 (red) revealed abundant Aβ immunoreactivity in the central amyloid plaque cores, while the 101-1-1 signal was restricted to surrounding dystrophic neurites. Scale bar: 100 µm.
Figure 5. Assessment of different antibody combinations, capture antibody titration, quantitative assay range, and comparison of alternative calibrators. (a) Comparison of sandwich immunoassay variations employing mAb 101-1-1-biotin or 280F2-biotin for capture and SULFO-TAG Aβ40, SULFO-TAG 280F2, or SULFO-TAG 101-1-1 for detection. The tested antibody combinations are indicated. (b) lower limit of detection (LLOD) and lower limit of quantification (LLOQ) of the Aβ-3-40 immunoassay as functions of the 101-1-1-biotin capture antibody concentration. (c) Determination of the quantitative assay range. Upper limit of quantification (ULOQ) and LLOQ were calculated from the signals obtained with an extended fourfold calibrator dilution series plus blank (zero calibrator). (d) Comparison of dose-response curves obtained with synthetic Aβ-3-40 and D7-Calibrator.
Figure 6. Impact of pre-analytical sample handling procedures on the measurement of Aβ-3-40. (a) Impact of pre-analytical freezing and thawing of diluted IP eluates. IP eluates obtained by 1E8 magnetic bead IP from aliquots of five individual and one pooled plasma sample were diluted with Diluent-35 and measured in the Aβ-3-40 assay freshly or after one or five freeze-thaw cycles. Mean calculated concentrations from two technical replicates on the assay plate and SDs are shown. (b) Impact of changing the starting volume and diluting the blood plasma used for IP. IPs from three different original blood plasma samples were done starting from 400 µL of EDTA plasma, from 200 µL of EDTA plasma mixed with 200 µL of Diluent-35, and from 100 µL of EDTA-Plasma plus 300 µL of Diluent-35. The resulting IP eluates were diluted 4.8-fold with Diluent-35 and stored at -80 °C until the analysis. Means ± SDs from triplicate reads are shown.
Figure 7. Receiver operating characteristic (ROC) analysis of Aβ42, the Aβ42/Aβ40 ratio, and the Aβ42/Aβ-3-40 ratio as discriminators of patients with other dementias (OD) and Alzheimer's type dementia (AD-D). The ROC curves of the indicated biomarker candidates in blood plasma are shown in discriminating the diagnostic groups OD and AD-D. The areas under the curves (AUCs) were 0.760 (Aβ42), 0.790 (Aβ42/Aβ-3-40 ratio), and 0.854 (Aβ42/Aβ40 ratio), respectively.
Sample | Concentration (pg/mL) | Signal | Calculated Concentration (pg/mL) | % Recognized |
---|---|---|---|---|
Aβ1–40 | 4000 | 93 | below detection range | n.a. |
Aβ1–40 | 20,000 | 79 | below detection range | n.a. |
Aβ−3–38 | 4000 | 93 | below detection range | n.a. |
Aβ−3–38 | 20,000 | 92 | below detection range | n.a. |
Aβ−3–42 | 4000 | 139 | 12.5 | 0.31 |
Aβ−3–42 | 20,000 | 594 | 51.6 | 0.26 |
Aβ1–42 | 4000 | 110 | below detection range | n.a. |
Aβ1–42 | 20,000 | 85 | below detection range | n.a. |
sAPPα | 320,000 | 91 | below detection range | n.a. |
zero calibrator | 0 | 88 | n.a. |
n.a.: not applicable, APP: amyloid precursor protein.
Assay Run | Mean Signal | Concentration (pg/mL) * |
---|---|---|
1 | 6755 | 193.60 |
2 | 7400 | 195.49 |
3 | 7022 | 204.52 |
4 | 7924 | 279.16 |
5 | 8216 | 214.36 |
Mean | 7463.40 | 217.43 |
SD | 608.12 | 35.48 |
%CV | 8.15 | 16.32 |
* on each assay plate, an aliquot of the same original diluted quality control (QC) immunoprecipitation (IP) eluate was measured in four technical replicates. The indicated concentrations refer to the mean calculated concentration in the diluted IP eluate without correction for dilution.
Sample | Signal * | Concentration (pg/mL) * |
---|---|---|
Zero calibrator (blank) | 94 | 0 |
HT7 magnetic bead IP (anti Tau) from plasma | 87 | Below detection range |
1E8 magnetic bead IP from plasma | 9140 | 239.4 |
1E8 magnetic bead IP from Aβ depleted plasma | 150 | 12.34 |
1E8 mock IP from PBS/0.1% w/v BSA | 86 | Below detection range |
* The indicated signals and calculated concentrations are the means of three technical replicates of the control IP eluates and two technical replicates (duplicate reads) of the zero calibrator (blank) on the assay plate. PBS: phoshate buffered saline, BSA: bovine serum albumin.
Spike | Measured Aβ−3–40 Concentration(pg/mL) * | Recovery (% of Control) |
---|---|---|
Control (no spike) | 183.93 | 100 |
Aβ1–40, 4.5 ng/mL | 185.72 | 101 |
Aβ1–40, 13.7 ng/mL | 188.39 | 102 |
Aβ1–40, 45 ng/mL | 174.96 | 95 |
sAPPα, 40 ng/mL | 166.58 | 91 |
sAPPα, 120 ng/mL | 154.51 | 84 |
sAPPα, 363 ng/mL | 136.16 | 74 |
Aβ−23–16, 4.5 ng/mL | 162.23 | 88 |
Aβ−23–16, 13.7 ng/mL | 141.70 | 77 |
Aβ−23–16, 45 ng/mL | 88.18 | 48 |
* The indicated concentrations are the means of four (control) or two (spiked IP eluates) replicate measurements on the assay plate.
Sample | 1E8-IP Round 1 | 1E8-IP Round 2 |
---|---|---|
Signal * | 8536 | 193 |
Concentration (pg/mL) | 229.77 | 17.29 |
* Mean of n = 3 technical replicates measured on the same assay plate.
Measured Concentration (pg/mL) | |||||
Spike Level | Neat | Low | Medium | High | |
Sample 1 | 266.6 | 334.6 | 382.8 | 413.1 | |
Sample 4 | 243.1 | 265.0 | 381.4 | 468.5 | |
Plasma pool | 213.4 | 281.9 | 350.9 | 400.6 | |
Control * | n.a. | n.d. | n.d. | 254.7 | |
Spike Recovery (pg) | |||||
Spike Level | Neat | Low | Medium | High | |
Sample 1 | n.a. | 9.8 | 16.7 | 21.1 | |
Sample 4 | n.a. | 3.2 | 19.9 | 32.5 | |
Plasma pool | n.a. | 9.9 | 19.8 | 27.0 | |
Control * | n.a. | n.a. | n.a. | 36.7 | |
Spike Recovery (%) | |||||
Spike Level | Neat | Low | Medium | High | |
Sample 1 | n.a. | 97.8 | 83.7 | 52.7 | |
Sample 4 | n.a. | 31.6 | 99.6 | 81.1 | |
Plasma pool | n.a. | 98.6 | 99.0 | 67.4 | |
Control * | n.a. | n.a. | n.a. | 91.7 |
* IP from 400 µL of Diluent-35 spiked with 40 pg of Aβ−3–40; n.a.: not applicable; n.d.: not determined.
Aβ−3–40 pg/mL | ||||||
---|---|---|---|---|---|---|
IP 1 | IP 2 | IP 3 | Mean | SD | %CV | |
Sample 1 | 237.45 | 211.09 | 233.63 | 227.39 | 14.24 | 6.26 |
Sample 2 | 217.73 | 211.88 | 217.60 | 215.74 | 3.34 | 1.55 |
Sample 3 | 183.42 | 207.80 | 203.71 | 198.31 | 13.06 | 6.58 |
Overall mean coefficient of variation (CV): 4.8%.
Measured Concentrations (cm) Aβ−3–40 (pg/mL) | |||||||
QC-Sample | Plate 1 | Plate 2 | Plate 3 | Plate 4 | Mean cm | SD | %CV |
QC-1 | 185.0 | 150.2 | 221.0 | 323.0 | 219.8 | 74.6 | 33.9 |
QC-2 | 258.0 | 160.2 | 257.3 | 336.0 | 252.9 | 72.0 | 28.5 |
QC-3 | 180.8 | 145.4 | 242.0 | 298.4 | 216.7 | 67.6 | 31.2 |
QC-pool | 227.2 | 192.7 | 234.2 | 336.4 | 247.6 | 61.9 | 25.0 |
overall mean %CV | 29.6 | ||||||
Normalized Concentrations (cnorm) (pg/mL) | |||||||
QC-Sample | Plate 1 | Plate 2 | Plate 3 | Plate 4 | Mean cnorm | SD | %CV |
QC-1 | 208.5 | 167.7 | 235.7 | 252.4 | 216.1 | 37.0 | 17.1 |
QC-2 | 290.8 | 178.9 | 274.5 | 262.2 | 251.7 | 49.9 | 19.8 |
QC-3 | 203.7 | 162.3 | 258.2 | 233.2 | 214.4 | 41.2 | 19.2 |
QC-pool | 256.1 | 215.0 | 249.8 | 246.0 | 246.0 | 21.3 | 8.7 |
overall mean %CV | 16.2 |
* Aβ−3–40 levels (cm) in three individual QC-plasma samples and one QC-plasma pool were determined in four independent runs of the two-step immunoassay (i.e., IP + immmunoassay). Normalized concentrations (cnorm) were calculated by means of specific correction factors for each assay plate.
Aβ−3–40 * | Aβ40 * | Aβ42 * | Aβ42/Aβ40 * | Aβ42/Aβ−3–40 * | |
---|---|---|---|---|---|
Significant? | No | No | Yes | Yes | Yes |
p-value | 0.65469 | 0.89737 | 0.01677 | 0.00003 | 0.00228 |
Mean of OD | 6.022 | 6.684 | 3.658 | −3.025 | −2.364 |
Mean of AD-D | 6.061 | 6.694 | 3.483 | −3.212 | −2.577 |
Difference | −0.0388 | −0.0103 | 0.1756 | 0.1873 | 0.2134 |
SE of difference | 0.0860 | 0.0792 | 0.0702 | 0.0392 | 0.0652 |
t ratio | 0.4508 | 0.1299 | 2.502 | 4.775 | 3.271 |
df | 38.00 | 38.00 | 38.00 | 38.00 | 38.00 |
Adjusted p-value ** | 0.88076 | 0.89737 | 0.04947 | 0.00013 | 0.00910 |
* log2-transformed data; ** corrections for multiple comparisons were done using the Holm–Sidak method, with alpha = 0.05 without assuming a consistent SD. Number of t-tests: 5.
Supplementary Materials
Supplementary materials can be found at https://www.mdpi.com/1422-0067/21/18/6564/s1.
Author Contributions
Conceptualization, H.W.K. and J.W.; Formal analysis, H.W.K.; Investigation, P.R., S.Z., D.O., and L.R.; Methodology, H.W.K., P.R., A.M., and O.J.; Resources, A.M., O.W., J.V., T.J.O., O.J., I.B., I.L., and H.-J.K.; Supervision J.W.; Validation, H.W.K. and P.R.; Visualization, H.W.K. and O.W.; Writing-original draft, H.W.K. and O.W.; Writing-review & editing, H.W.K., S.Z., O.W., J.V., D.O., T.J. Oberstein, O.J., I.L., and H.-J.K. All authors have read and agreed to the published version of the manuscript.
Funding
J.W. is supported by an Ilídio Pinho professorship and iBiMED (UID/BIM/04501/2013) at the University of Aveiro, Portugal. J.W. is also supported by FCT project PTDC/DTP_PIC/5587/2014 and POCI-01-0145-FEDER-016904. J.V. was funded by the Deutsche Forschungsgemeinschaft (DFG, German Research Foundation)-project number 413501650.
Acknowledgments
The authors thank A. Jahn-Brodmann, T. Liepold, and L. van Werven for expert technical assistance.
Conflicts of Interest
J.W. is a consultant or member of the advisory board for Abbott, Biogen, Boehringer Ingelheim, Immungenetics, Lilly, MSD Sharp & Dohme, and Roche Pharma. He received fees for lectures from Actelion Pharmaceuticals, Amgen, Janssen-Cilag, and Pfizer. A.M. is a full-time employee of IBL International GmbH, Tecan Group Company, Hamburg, Germany. D.O. and I.L. are full time employees of Roboscreen GmbH, Leipzig, Germany.
Abbreviations
AD | Alzheimer's disease |
Aβ | amyloid β |
APP | amyloid precursor protein |
PET | positron-emission tomography |
mAb | monoclonal antibody |
BSA | bovine serum albumin |
IP | immunoprecipitation |
CHAPS | 3-(3-cholamidopropyl) dimethylammonio)-1-propanesulfonate |
LLOD | lower limit of detection |
LLOQ | lower limit of quantification |
HABA | 4-hydroxyazobenzene-2-carboxylic acid |
BCA | bicinchoninic acid |
SOP | standard operating procedure |
ULOQ | upper limit of quantification |
CV | coefficient of variation |
PEG2 | 8-Amino-3,6-dioxaoctanoic acid |
QC | quality control |
AD-D | dementia of the Alzheimer's type |
OD | other dementias |
ROC | receiver operating characteristic |
AUC | area under the curve |
BES | N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid |
1. Lane, C.A.; Hardy, J.; Schott, J.M. Alzheimer's disease. Eur. J. Neurol. 2018, 25, 59-70.
2. Glenner, G.G.; Wong, C.W. Alzheimer's disease: Initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem. Biophys. Res. Commun. 1984, 120, 885-890.
3. Masters, C.L.; Simms, G.; Weinman, N.A.; Multhaup, G.; McDonald, B.L.; Beyreuther, K. Amyloid plaque core protein in Alzheimer disease and Down syndrome. Proc. Natl. Acad. Sci. USA 1985, 82, 4245-4249.
4. Selkoe, D.J. The cell biology of beta-amyloid precursor protein and presenilin in Alzheimer's disease. Trends Cell Biol. 1998, 8, 447-453.
5. Huang, Y.R.; Liu, R.T. The Toxicity and Polymorphism of beta-Amyloid Oligomers. Int. J. Mol. Sci. 2020, 21, 4477.
6. Portelius, E.; Bogdanovic, N.; Gustavsson, M.K.; Volkmann, I.; Brinkmalm, G.; Zetterberg, H.; Winblad, B.; Blennow, K. Mass spectrometric characterization of brain amyloid beta isoform signatures in familial and sporadic Alzheimer's disease. Acta Neuropathol. 2010, 120, 185-193.
7. Wildburger, N.C.; Esparza, T.J.; LeDuc, R.D.; Fellers, R.T.; Thomas, P.M.; Cairns, N.J.; Kelleher, N.L.; Bateman, R.J.; Brody, D.L. Diversity of Amyloid-beta Proteoforms in the Alzheimer's Disease Brain. Sci. Rep. 2017, 7, 9520.
8. Zampar, S.; Klafki, H.W.; Sritharen, K.; Bayer, T.A.; Wiltfang, J.; Rostagno, A.; Ghiso, J.; Miles, L.A.; Wirths, O. N-terminal heterogeneity of parenchymal and vascular amyloid-beta deposits in Alzheimer's disease. Neuropathol. Appl. Neurobiol. 2020, 10.
9. Wirths, O.; Zampar, S. Emerging roles of N- and C-terminally truncated Abeta species in Alzheimer's disease. Expert Opin. Ther. Targets 2019, 23, 991-1004.
10. Dunys, J.; Valverde, A.; Checler, F. Are N- and C-terminally truncated Abeta species key pathological triggers in Alzheimer's disease? J. Biol. Chem. 2018, 293, 15419-15428.
11. Saido, T.C.; Iwatsubo, T.; Mann, D.M.; Shimada, H.; Ihara, Y.; Kawashima, S. Dominant and differential deposition of distinct beta-amyloid peptide species, A beta N3(pE), in senile plaques. Neuron 1995, 14, 457-466.
12. Schlenzig, D.; Ronicke, R.; Cynis, H.; Ludwig, H.H.; Scheel, E.; Reymann, K.; Saido, T.; Hause, G.; Schilling, S.; Demuth, H.U. N-Terminal pyroglutamate formation of Abeta38 and Abeta40 enforces oligomer formation and potency to disrupt hippocampal long-term potentiation. J. Neurochem. 2012, 121, 774-784.
13. He, W.; Barrow, C.J. The A beta 3-pyroglutamyl and 11-pyroglutamyl peptides found in senile plaque have greater beta-sheet forming and aggregation propensities in vitro than full-length A beta. Biochemistry 1999, 38, 10871-10877.
14. Gunn, A.P.; Wong, B.X.; Johanssen, T.; Griffith, J.C.; Masters, C.L.; Bush, A.I.; Barnham, K.J.; Duce, J.A.; Cherny, R.A. Amyloid-beta Peptide Abeta3pE-42 Induces Lipid Peroxidation, Membrane Permeabilization, and Calcium Influx in Neurons. J. Biol. Chem. 2016, 291, 6134-6145.
15. Russo, C.; Violani, E.; Salis, S.; Venezia, V.; Dolcini, V.; Damonte, G.; Benatti, U.; D'Arrigo, C.; Patrone, E.; Carlo, P.; et al. Pyroglutamate-modified amyloid beta-peptides--AbetaN3(pE)--strongly affect cultured neuron and astrocyte survival. J. Neurochem. 2002, 82, 1480-1489.
16. Scheidt, H.A.; Das, A.; Korn, A.; Krueger, M.; Maiti, S.; Huster, D. Structural characteristics of oligomers formed by pyroglutamate-modified amyloid beta peptides studied by solid-state NMR. Phys. Chem. Chem. Phys. 2020, 22, 16887-16895.
17. Blennow, K.; Zetterberg, H. The Past and the Future of Alzheimer's Disease Fluid Biomarkers. J. Alzheimer's Dis. 2018, 62, 1125-1140.
18. Cummings, J. The Role of Biomarkers in Alzheimer's Disease Drug Development. Adv. Exp. Med. Biol. 2019, 1118, 29-61.
19. Ovod, V.; Ramsey, K.N.; Mawuenyega, K.G.; Bollinger, J.G.; Hicks, T.; Schneider, T.; Sullivan, M.; Paumier, K.; Holtzman, D.M.; Morris, J.C.; et al. Amyloid beta concentrations and stable isotope labeling kinetics of human plasma specific to central nervous system amyloidosis. Alzheimer's Dement. 2017, 13, 841-849.
20. Schindler, S.E.; Bollinger, J.G.; Ovod, V.; Mawuenyega, K.G.; Li, Y.; Gordon, B.A.; Holtzman, D.M.; Morris, J.C.; Benzinger, T.L.S.; Xiong, C.; et al. High-precision plasma beta-amyloid 42/40 predicts current and future brain amyloidosis. Neurology 2019, 93, e1647-e1659.
21. Shahpasand-Kroner, H.; Klafki, H.W.; Bauer, C.; Schuchhardt, J.; Huttenrauch, M.; Stazi, M.; Bouter, C.; Wirths, O.; Vogelgsang, J.; Wiltfang, J. A two-step immunoassay for the simultaneous assessment of Abeta38, Abeta40 and Abeta42 in human blood plasma supports the Abeta42/Abeta40 ratio as a promising biomarker candidate of Alzheimer's disease. Alzheimer's Res. Ther. 2018, 10, 121.
22. Kaneko, N.; Nakamura, A.; Washimi, Y.; Kato, T.; Sakurai, T.; Arahata, Y.; Bundo, M.; Takeda, A.; Niida, S.; Ito, K.; et al. Novel plasma biomarker surrogating cerebral amyloid deposition. Proc. Jpn. Acad. Ser. B Phys. Biol. Sci. 2014, 90, 353-364.
23. Nakamura, A.; Kaneko, N.; Villemagne, V.L.; Kato, T.; Doecke, J.; Dore, V.; Fowler, C.; Li, Q.X.; Martins, R.; Rowe, C.; et al. High performance plasma amyloid-beta biomarkers for Alzheimer's disease. Nature 2018, 554, 249-254.
24. Kaneko, N.; Yamamoto, R.; Sato, T.A.; Tanaka, K. Identification and quantification of amyloid beta-related peptides in human plasma using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. Proc. Jpn. Acad. Ser. B Phys. Biol. Sci. 2014, 90, 104-117.
25. Beyer, I.; Rezaei-Ghaleh, N.; Klafki, H.W.; Jahn, O.; Haussmann, U.; Wiltfang, J.; Zweckstetter, M.; Knölker, H.J. Solid-Phase Synthesis and Characterization of N-Terminally Elongated Abeta-3-x -Peptides. Chemistry 2016, 22, 8685-8693.
26. Haussmann, U.; Jahn, O.; Linning, P.; Janssen, C.; Liepold, T.; Portelius, E.; Zetterberg, H.; Bauer, C.; Schuchhardt, J.; Knölker, H.J.; et al. Analysis of amino-terminal variants of amyloid-beta peptides by capillary isoelectric focusing immunoassay. Anal. Chem. 2013, 85, 8142-8149.
27. An, S.S.A.; Lee, B.S.; Yu, J.S.; Lim, K.; Kim, G.J.; Lee, R.; Kim, S.; Kang, S.; Park, Y.H.; Wang, M.J.; et al. Dynamic changes of oligomeric amyloid beta levels in plasma induced by spiked synthetic Abeta42. Alzheimer's Res. Ther. 2017, 9, 86.
28. Wang, M.J.; Yi, S.; Han, J.Y.; Park, S.Y.; Jang, J.W.; Chun, I.K.; Kim, S.E.; Lee, B.S.; Kim, G.J.; Yu, J.S.; et al. Oligomeric forms of amyloid-beta protein in plasma as a potential blood-based biomarker for Alzheimer's disease. Alzheimer's Res. Ther. 2017, 9, 98.
29. Meng, X.; Li, T.; Wang, X.; Lv, X.; Sun, Z.; Zhang, J.; Su, F.; Kang, S.; Kim, S.; An, S.S.A.; et al. Association between increased levels of amyloid-beta oligomers in plasma and episodic memory loss in Alzheimer's disease. Alzheimer's Res. Ther. 2019, 11, 89.
30. Lee, J.J.; Choi, Y.; Chung, S.; Yoon, D.H.; Choi, S.H.; Kang, S.M.; Seo, D.; Park, K.I. Association of Plasma Oligomerized Beta Amyloid with Neurocognitive Battery Using Korean Version of Consortium to Establish a Registry for Alzheimer's Disease in Health Screening Population. Diagnostics 2020, 10, 237.
31. Klafki, H.W.; Wiltfang, J.; Staufenbiel, M. Electrophoretic separation of betaA4 peptides (1-40) and (1-42). Anal. Biochem. 1996, 237, 24-29.
32. Wiltfang, J.; Smirnov, A.; Schnierstein, B.; Kelemen, G.; Matthies, U.; Klafki, H.W.; Staufenbiel, M.; Huther, G.; Ruther, E.; Kornhuber, J. Improved electrophoretic separation and immunoblotting of beta-amyloid (A beta) peptides 1-40, 1-42, and 1-43. Electrophoresis 1997, 18, 527-532.
33. Schieb, H.; Kratzin, H.; Jahn, O.; Mobius, W.; Rabe, S.; Staufenbiel, M.; Wiltfang, J.; Klafki, H.W. Beta-amyloid peptide variants in brains and cerebrospinal fluid from amyloid precursor protein (APP) transgenic mice: Comparison with human Alzheimer amyloid. J. Biol. Chem. 2011, 286, 33747-33758.
34. Oakley, H.; Cole, S.L.; Logan, S.; Maus, E.; Shao, P.; Craft, J.; Guillozet-Bongaarts, A.; Ohno, M.; Disterhoft, J.; Van Eldik, L.; et al. Intraneuronal beta-amyloid aggregates, neurodegeneration, and neuron loss in transgenic mice with five familial Alzheimer's disease mutations: Potential factors in amyloid plaque formation. J. Neurosci. 2006, 26, 10129-10140.
35. Van Dorpe, J.; Smeijers, L.; Dewachter, I.; Nuyens, D.; Spittaels, K.; Van Den Haute, C.; Mercken, M.; Moechars, D.; Laenen, I.; Kuiperi, C.; et al. Prominent cerebral amyloid angiopathy in transgenic mice overexpressing the london mutant of human APP in neurons. Am. J. Pathol. 2000, 157, 1283-1298.
36. Wirths, O.; Multhaup, G.; Czech, C.; Feldmann, N.; Blanchard, V.; Tremp, G.; Beyreuther, K.; Pradier, L.; Bayer, T.A. Intraneuronal APP/A beta trafficking and plaque formation in beta-amyloid precursor protein and presenilin-1 transgenic mice. Brain Pathol. 2002, 12, 275-286.
37. Wiltfang, J.; Esselmann, H.; Cupers, P.; Neumann, M.; Kretzschmar, H.; Beyermann, M.; Schleuder, D.; Jahn, H.; Ruther, E.; Kornhuber, J.; et al. Elevation of beta-amyloid peptide 2-42 in sporadic and familial Alzheimer's disease and its generation in PS1 knockout cells. J. Biol. Chem. 2001, 276, 42645-42657.
Hans W. Klafki1,*, Petra Rieper1, Anja Matzen2, Silvia Zampar1, Oliver Wirths1, Jonathan Vogelgsang1, Dirk Osterloh3, Lara Rohdenburg1, Timo J. Oberstein4, Olaf Jahn5, Isaak Beyer6, Ingolf Lachmann3, Hans-Joachim Knölker6 and Jens Wiltfang1,7,8
1Department of Psychiatry and Psychotherapy, University Medical Center (UMG), Georg-August-University, D37075 Göttingen, Germany
2IBL International GmbH, Tecan Group Company, D-22335 Hamburg, Germany
3Roboscreen GmbH, D-04129 Leipzig, Germany
4Department of Psychiatry and Psychotherapy, Friedrich-Alexander-University of Erlangen-Nuremberg, D-91054 Erlangen, Germany
5Max-Planck-Institute of Experimental Medicine, Proteomics Group, D-37075 Göttingen, Germany
6Faculty of Chemistry, Technische Universität Dresden, D-01069 Dresden, Germany
7German Center for Neurodegenerative Diseases (DZNE), D-37075 Göttingen, Germany
8Neurosciences and Signaling Group, Institute of Biomedicine (iBiMED), Department of Medical Sciences, University of Aveiro, 3810-193 Aveiro, Portugal
*Author to whom correspondence should be addressed.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer
© 2020. This work is licensed under http://creativecommons.org/licenses/by/3.0/ (the “License”). Notwithstanding the ProQuest Terms and Conditions, you may use this content in accordance with the terms of the License.
Abstract
The ratio of amyloid precursor protein (APP)669–711 (Aβ−3–40)/Aβ1–42 in blood plasma was reported to represent a novel Alzheimer’s disease biomarker. Here, we describe the characterization of two antibodies against the N-terminus of Aβ−3–x and the development and “fit-for-purpose” technical validation of a sandwich immunoassay for the measurement of Aβ−3–40. Antibody selectivity was assessed by capillary isoelectric focusing immunoassay, Western blot analysis, and immunohistochemistry. The analytical validation addressed assay range, repeatability, specificity, between-run variability, impact of pre-analytical sample handling procedures, assay interference, and analytical spike recoveries. Blood plasma was analyzed after Aβ immunoprecipitation by a two-step immunoassay procedure. Both monoclonal antibodies detected Aβ−3–40 with no appreciable cross reactivity with Aβ1–40 or N-terminally truncated Aβ variants. However, the amyloid precursor protein was also recognized. The immunoassay showed high selectivity for Aβ−3–40 with a quantitative assay range of 22 pg/mL–7.5 ng/mL. Acceptable intermediate imprecision of the complete two-step immunoassay was reached after normalization. In a small clinical sample, the measured Aβ42/Aβ−3–40 and Aβ42/Aβ40 ratios were lower in patients with dementia of the Alzheimer’s type than in other dementias. In summary, the methodological groundwork for further optimization and future studies addressing the Aβ42/Aβ−3–40 ratio as a novel biomarker candidate for Alzheimer’s disease has been set.
You have requested "on-the-fly" machine translation of selected content from our databases. This functionality is provided solely for your convenience and is in no way intended to replace human translation. Show full disclaimer
Neither ProQuest nor its licensors make any representations or warranties with respect to the translations. The translations are automatically generated "AS IS" and "AS AVAILABLE" and are not retained in our systems. PROQUEST AND ITS LICENSORS SPECIFICALLY DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, ANY WARRANTIES FOR AVAILABILITY, ACCURACY, TIMELINESS, COMPLETENESS, NON-INFRINGMENT, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Your use of the translations is subject to all use restrictions contained in your Electronic Products License Agreement and by using the translation functionality you agree to forgo any and all claims against ProQuest or its licensors for your use of the translation functionality and any output derived there from. Hide full disclaimer